Actinoplanes ianthinogenes: Aiant_34570 Help Entry Aiant_34570       CDS       T07429                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism aih  Actinoplanes ianthinogenes Brite KEGG Orthology (KO) [BR:aih00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Aiant_34570 Enzymes [BR:aih01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      Aiant_34570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin_2 Glrx-like Thioredoxin SH3BGR VpsR Motif Other DBs NCBI-ProteinID:  BCJ42800 LinkDB All DBs Position 3823455..3823697 Genome browser AA seq 80 aa AA seqDB search MLTMYSTSWCGYCHRLKSQLDREGIAYDVVDIEQDEASAAFVRSVNGGNQTVPTLKFDDG SALTNPSIVQVKQHLAAISA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgctgaccatgtactcgacgtcctggtgtgggtattgccaccggctcaagagccagctc gaccgcgagggcatcgcctacgacgtcgtggacatcgagcaggacgaggcctcggccgcg ttcgtccgcagcgtgaacggcggcaaccagacggtgcccacgctcaagttcgacgacggc tcggcgctgaccaacccgtcgatcgtccaggtcaagcagcacctggccgcgatctccgcc tga

DBGET integrated database retrieval system