Actinoplanes ianthinogenes: Aiant_57670 Help Entry Aiant_57670       CDS       T07429                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aih  Actinoplanes ianthinogenes Pathway aih00998   Biosynthesis of various antibiotics aih01100   Metabolic pathways aih01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aih00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Aiant_57670 (acpP)    00074 Mycolic acid biosynthesis     Aiant_57670 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Aiant_57670 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BCJ45110 LinkDB All DBs Position complement(6288624..6288866) Genome browser AA seq 80 aa AA seqDB search MATREEITSGLAEILEEVAGVNPDDVAESKSFTDDLDVDSLSMVEVVVAAEEKFGVKIPD NEVQNLKTVGDAVTYIEANH NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggctactcgcgaagagatcacctctggcctcgccgagatcctcgaggaggtcgccggg gtgaacccggacgacgtcgccgagagcaagtccttcaccgacgacctggacgtcgactcg ctgtcgatggtcgaggtcgtggtggccgccgaggagaagttcggcgtcaagatcccggac aacgaggtgcagaacctcaagaccgtcggtgacgcggtcacctacatcgaggcgaaccac tga

DBGET integrated database retrieval system