Allofrancisella inopinata: E4K63_02070 Help Entry E4K63_02070       CDS       T06698                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aii  Allofrancisella inopinata Pathway aii01100   Metabolic pathways aii01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aii00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E4K63_02070 (acpP)    00074 Mycolic acid biosynthesis     E4K63_02070 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E4K63_02070 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QIV95680 UniProt:  A0AAE6YGV0 LinkDB All DBs Position 445920..446162 Genome browser AA seq 80 aa AA seqDB search MSANELYAKVNSIIVEQLGVKEEDLKPEASFIDDLGADSLDTVELVMALEEEFDTEIPDE DAEKIRTVKDVYDYIDSKVN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgcaaacgaattatatgctaaagtaaactctatcatagtagaacaattaggcgtt aaagaagaagaccttaagccagaggcttcttttattgatgatttaggtgccgactctctt gatacagttgagttagtaatggctctagaagaagagtttgacactgaaattcctgacgaa gatgctgaaaaaatcagaactgttaaagatgtttacgactatatagattctaaagtaaac taa

DBGET integrated database retrieval system