Agromyces intestinalis: FLP10_00495 Help Entry FLP10_00495       CDS       T09895                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ail  Agromyces intestinalis Pathway ail01100   Metabolic pathways ail01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ail00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FLP10_00495    00074 Mycolic acid biosynthesis     FLP10_00495   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FLP10_00495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QEO13063 UniProt:  A0A5C1YA50 LinkDB All DBs Position 100583..100831 Genome browser AA seq 82 aa AA seqDB search MALSTEEVLAGLAELINDETGIATDTVELDKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVKNLKTVGDAVDFIVKAQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcactgtccaccgaagaagtgctggccggcctggccgagctcatcaacgacgagacc ggcatcgcgaccgacacggtcgagctggacaagtcgttcaccgatgacctcgacatcgac tccatctcgatgatgacgatcgtcgtcaacgccgaggagaagttcgacgtcaagatcccc gacgaagaggtcaagaacctcaagaccgtcggcgacgccgtcgacttcatcgtcaaggcc caggcctag

DBGET integrated database retrieval system