Amygdalobacter indicium: PYS61_05425 Help Entry PYS61_05425       CDS       T09413                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aim  Amygdalobacter indicium Pathway aim01100   Metabolic pathways aim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PYS61_05425 (acpP)    00074 Mycolic acid biosynthesis     PYS61_05425 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PYS61_05425 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  WEG35370 LinkDB All DBs Position complement(1285395..1285634) Genome browser AA seq 79 aa AA seqDB search MSEKEILDKVTKILVDQLDVKPEEVVPDANFLEDLNADSLDIVELILVMEEEFNFQIPDE DAEKIQTVGDAVKYIKEHI NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgaaaaagaaatattggataaggttactaaaattttagtagatcaactggatgtt aagccggaagaagtagtaccggatgctaatttcctggaagatttgaatgccgactcgttg gatattgtggaattgattttggtaatggaagaagagtttaattttcaaatcccggatgaa gatgccgaaaaaattcaaacggtcggagatgcggttaaatatatcaaggaacatatttaa

DBGET integrated database retrieval system