Actinobacillus indolicus: EXH44_06670 Help Entry EXH44_06670       CDS       T05940                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aio  Actinobacillus indolicus Pathway aio01100   Metabolic pathways aio01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aio00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EXH44_06670    00074 Mycolic acid biosynthesis     EXH44_06670   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EXH44_06670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QBQ63938 UniProt:  A0A4P7CFZ5 LinkDB All DBs Position 1347053..1347337 Genome browser AA seq 94 aa AA seqDB search MKYQFTLEPELLELELKKLIIQESEKDDFAPEDISDDEWLFGEQSRIQLDSLDALQIVVA LQAHFKVRLQGDRMVRKHMMCVKDLAKFVRESHS NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaaataccaatttaccctagaacccgaattgctcgaattagagttaaaaaaactgatt atccaagaaagcgagaaagacgattttgcacccgaagacatcagcgatgatgaatggctg tttggtgaacaaagtcgtattcagctggactccttagacgcgttacaaattgtggtggcg ttgcaagcgcattttaaagtgcggttgcaaggggatagaatggtgcgtaagcatatgatg tgtgtgaaagatttggcaaaatttgtgcgtgagagccattcataa

DBGET integrated database retrieval system