Arachis ipaensis: 107611097 Help Entry 107611097         CDS       T04301                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A Organism aip  Arachis ipaensis Pathway aip04144   Endocytosis aip04145   Phagosome aip04148   Efferocytosis Brite KEGG Orthology (KO) [BR:aip00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107611097    04145 Phagosome     107611097    04148 Efferocytosis     107611097  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aip04131]     107611097   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aip04147]     107611097    04031 GTP-binding proteins [BR:aip04031]     107611097 Membrane trafficking [BR:aip04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     107611097 Exosome [BR:aip04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107611097   Exosomal proteins of other body fluids (saliva and urine)    107611097   Exosomal proteins of colorectal cancer cells    107611097   Exosomal proteins of bladder cancer cells    107611097 GTP-binding proteins [BR:aip04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     107611097 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  107611097 NCBI-ProteinID:  XP_020965145 LinkDB All DBs Position B08:complement(67649547..67650046) Genome browser AA seq 135 aa AA seqDB search MRLFWHIWDTVGQERFNSLGAAFYGGADCCVLVYDVNAHNTFDTLNNWHDEFIKQADLND HEAFPFVLLGNKVDVDGGNSRKVLKRVWAFEINMHSFEVEISFNLLQVTEKKAREWCASR GKSGDPFLHLIPFQV NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgagactcttttggcatatttgggatacagtaggacaagaaaggttcaatagtttaggt gctgcattttatggaggtgcagattgttgtgttttggtgtatgatgtaaatgcacacaac acatttgacacactaaacaattggcatgatgagttcattaaacaggcagatttgaatgat catgaagcatttccctttgtgttacttgggaacaaggttgatgtagatggtgggaacagt agaaaggtattaaaaagagtttgggcctttgagattaatatgcatagttttgaagttgaa atctcattcaacttgttgcaggtgactgagaagaaagctagggaatggtgtgcttctaga ggcaagtctggagacccctttcttcatttaatcccatttcaggtgtga

DBGET integrated database retrieval system