Arachis ipaensis: 107619474 Help Entry 107619474         CDS       T04301                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism aip  Arachis ipaensis Pathway aip04136   Autophagy - other Brite KEGG Orthology (KO) [BR:aip00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     107619474  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aip04131]     107619474    04121 Ubiquitin system [BR:aip04121]     107619474    03029 Mitochondrial biogenesis [BR:aip03029]     107619474 Membrane trafficking [BR:aip04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     107619474 Ubiquitin system [BR:aip04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    107619474 Mitochondrial biogenesis [BR:aip03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     107619474 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  107619474 NCBI-ProteinID:  XP_016177258 LinkDB All DBs Position B09:complement(16302916..16306660) Genome browser AA seq 94 aa AA seqDB search MAAESPSSVRKVVVHLRATGDAPILKQSKFKIAGADKFAKVIDFLRRQLHRETLFVYVNS AFSPNPDESIIDLYTNFGFDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctgctgagtcaccaagttccgttcgtaaagtggttgttcatctgagagccactggt gatgctcctattctcaagcaatctaaattcaagatagcaggagctgataaatttgcaaag gttatagactttcttagacggcaactccacagggaaacattgtttgtatatgtcaacagt gctttttcacccaatcctgatgaatcgatcattgatttgtatactaattttggttttgat ggcaaattggtggtcaactacgcatgttctatggcatggggctaa

DBGET integrated database retrieval system