Arachis ipaensis: 107633902 Help Entry 107633902         CDS       T04301                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism aip  Arachis ipaensis Pathway aip03083   Polycomb repressive complex aip04120   Ubiquitin mediated proteolysis aip04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aip00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107633902    04120 Ubiquitin mediated proteolysis     107633902   09126 Chromosome    03083 Polycomb repressive complex     107633902  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aip04131]     107633902    04121 Ubiquitin system [BR:aip04121]     107633902    03036 Chromosome and associated proteins [BR:aip03036]     107633902 Membrane trafficking [BR:aip04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107633902 Ubiquitin system [BR:aip04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107633902    Cul7 complex      107633902 Chromosome and associated proteins [BR:aip03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107633902   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107633902 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  107633902 NCBI-ProteinID:  XP_016193007 LinkDB All DBs Position B01:77419..78133 Genome browser AA seq 155 aa AA seqDB search MASTKKITLKSSDGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVDAAASEEKPSEEDLKMWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcgtcaacgaagaagatcactttgaaaagttccgatggcgaggcgtttgaggttgac gaggcagtggctctcgaatcgcagacgatcaagcacatgatcgaagacgattgcgctgac agtggaattcctcttccaaacgtcaccagcaagatccttgcgaaggtgattgagtattgc aagaagcacgtcgatgctgctgcttccgaggagaagccatccgaggaggatctcaagatg tgggatgctgaattcgttaaggtcgatcaggccacgctcttcgatctcattctggctgca aactacttgaacatcaagagcctcttggaccttacttgccagacagtggcagacatgatc aagggcaagactccggaggagattcgcaagacattcaatatcaagaatgacttcacgccg gaggaggaggaggaggtccgccgcgaaaaccagtgggcgtttgaatga

DBGET integrated database retrieval system