Arachis ipaensis: 107634545 Help Entry 107634545         CDS       T04301                                  Name (RefSeq) sm-like protein LSM36B   KO K12625   U6 snRNA-associated Sm-like protein LSm6 Organism aip  Arachis ipaensis Pathway aip03018   RNA degradation aip03040   Spliceosome Brite KEGG Orthology (KO) [BR:aip00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     107634545   09123 Folding, sorting and degradation    03018 RNA degradation     107634545  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aip03019]     107634545    03041 Spliceosome [BR:aip03041]     107634545 Messenger RNA biogenesis [BR:aip03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      107634545   mRNA degradation factors    5'-3' decay     Lsm complex      107634545 Spliceosome [BR:aip03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     107634545 SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX Motif Other DBs NCBI-GeneID:  107634545 NCBI-ProteinID:  XP_016193477 LinkDB All DBs Position B03 Genome browser AA seq 95 aa AA seqDB search MSGAAEKEKEKGSGTTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGYMNIAMEQTE EYVNGQLKNKYGDAFIRGNNVLYISTSKRTLAEGA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgagtggagcagcggagaaagagaaagagaaaggatctggaaccacaaagacccctgct gatttcctcaagtccattcgcggccgccccgttgttgtcaagctcaattctggcgttgat tatcgtggtatcctggcttgtcttgatggctatatgaatattgcaatggaacaaacagag gagtatgtcaacgggcaactgaagaacaagtatggtgatgccttcattcgagggaataat gttctatacattagtacctcaaagaggactctagcagaaggggcgtag

DBGET integrated database retrieval system