Arachis ipaensis: 107638128 Help Entry 107638128         CDS       T04301                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism aip  Arachis ipaensis Pathway aip03083   Polycomb repressive complex aip04120   Ubiquitin mediated proteolysis aip04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aip00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107638128    04120 Ubiquitin mediated proteolysis     107638128   09126 Chromosome    03083 Polycomb repressive complex     107638128  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aip04131]     107638128    04121 Ubiquitin system [BR:aip04121]     107638128    03036 Chromosome and associated proteins [BR:aip03036]     107638128 Membrane trafficking [BR:aip04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107638128 Ubiquitin system [BR:aip04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107638128    Cul7 complex      107638128 Chromosome and associated proteins [BR:aip03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107638128   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107638128 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Methyltransf_16 Motif Other DBs NCBI-GeneID:  107638128 NCBI-ProteinID:  XP_016196788 LinkDB All DBs Position B04:complement(126645599..126646328) Genome browser AA seq 150 aa AA seqDB search MASTKKITLKSSNGEAFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVNAAASEEDLKMWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKTP EEIRKTFNIKNDFTPEEEEEIRRENQWAFE NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atggcgtcaacgaagaagatcactttgaaaagttccaatggcgaggcgtttgaggttgac gaggcagtggctctcgaatcgcagacgatcaagcacatgatcgaagacgattgcgctgac agtggaattcctcttccaaacgtcaccagcaagatccttgcgaaggtgattgagtattgc aagaagcacgtcaatgctgctgcttccgaggaggatctcaagatgtgggatgctgaattc gttaaggtcgatcaggccactctcttcgatctcattctggctgcaaactacttgaacatc aagagcctcttggaccttacttgccagacagtggcagacatgatcaaaggcaagactccg gaggagattcgcaagacattcaatatcaaaaatgacttcacgccggaggaggaggaggag atccgccgcgaaaaccagtgggcgtttgaatga

DBGET integrated database retrieval system