Actinomyces israelii: AIF0345_0359 Help Entry AIF0345_0359      CDS       T06659                                  Name (GenBank) hypothetical protein   KO K05553   minimal PKS acyl carrier protein Organism air  Actinomyces israelii Pathway air01056   Biosynthesis of type II polyketide backbone air01100   Metabolic pathways air01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:air00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     AIF0345_0359    00253 Tetracycline biosynthesis     AIF0345_0359  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:air01004]     AIF0345_0359    01008 Polyketide biosynthesis proteins [BR:air01008]     AIF0345_0359 Lipid biosynthesis proteins [BR:air01004]  Polyketide synthase   Component type    AIF0345_0359 Polyketide biosynthesis proteins [BR:air01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      AIF0345_0359     Nonaketide PKS      AIF0345_0359     Decaketide PKS      AIF0345_0359 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WKR20479 LinkDB All DBs Position 451483..451740 Genome browser AA seq 85 aa AA seqDB search MKDIEFLLRGIVSEVDMKKICAQPENFVNLPLTHLGVDSIAVFEVLERIESRIGHQLDYD KLDYEDLITLEGLLRLLGPGSDGID NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaaagatattgaatttttgttacgtggaattgtttcagaagttgatatgaaaaaaata tgtgcacaacccgagaacttcgtgaatttgcctttgacgcatctcggcgtcgacagcatc gcagtttttgaggtgctggagagaattgagagccgaatcggccaccaattggactacgat aagctggactatgaagacctgattacgctcgagggacttctccgccttctcgggcccggt agtgacggaattgattga

DBGET integrated database retrieval system