Actinomyces israelii: AIF0345_0741 Help Entry AIF0345_0741      CDS       T06659                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism air  Actinomyces israelii Pathway air01100   Metabolic pathways air01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:air00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AIF0345_0741    00074 Mycolic acid biosynthesis     AIF0345_0741   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AIF0345_0741 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WKR20854 LinkDB All DBs Position 910513..910785 Genome browser AA seq 90 aa AA seqDB search MSELRAHAQERFDLVGRVTEMLIDGLDLPDDPARVDPDQPLFGRGLELDSLDTLEIVSLI DEEYSVTLEDTPAAFGSINRIVDQLCDRRS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgtcagaactgcgagcacatgcacaggagcgtttcgacctggtgggccgggtcaccgag atgctcatcgacggacttgacctgccggacgatcctgcgcgggtcgaccctgatcagccc ctcttcggacgcggactcgagcttgactcactggacacacttgagattgtcagcctcatt gacgaggagtacagcgtcacgctggaggacaccccggcggcgttcgggtccatcaatagg atcgttgaccagctgtgtgacaggcggtcatga

DBGET integrated database retrieval system