Argopecten irradians (bay scallop): 138332306 Help Entry 138332306         CDS       T10542                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism airr  Argopecten irradians (bay scallop) Pathway airr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:airr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     138332306  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:airr04121]     138332306    03400 DNA repair and recombination proteins [BR:airr03400]     138332306 Ubiquitin system [BR:airr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      138332306    Cul5 complex      138332306 DNA repair and recombination proteins [BR:airr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      138332306 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  138332306 NCBI-ProteinID:  XP_069136446 LinkDB All DBs Position 9:39607223..39615358 Genome browser AA seq 120 aa AA seqDB search MDVFLMIRRRKCTIFTDAKESTTVHEVKKIIEGILKTRPDDQKLYKDDQPLDDNKTLGDL GFTYGTARAQAPATIGLAFRQEDGEFEALEVTPLSCPPELPDVMKPQDSTSAHAQEQTAS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttttgatgattagacgcaggaaatgcaccatcttcacagatgcaaaggag tccaccacagtacacgaagtaaagaaaataatagagggtatattgaaaactaggccagat gatcagaagctttacaaagatgatcagccactagatgacaataaaacacttggtgatttg ggtttcacatatggtacagcaagagcacaggcaccagcaacaattggtttggctttcaga caggaagatggagaatttgaagctttagaagtgacaccattgtcctgtcccccagaacta ccagacgttatgaagccacaagattccacttctgcacatgcacaagaacaaacagcgtcg taa

DBGET integrated database retrieval system