Argopecten irradians (bay scallop): 138336475 Help Entry 138336475         CDS       T10542                                  Name (RefSeq) ras-related protein Rab-11A-like   KO K07904   Ras-related protein Rab-11A Organism airr  Argopecten irradians (bay scallop) Pathway airr04144   Endocytosis Brite KEGG Orthology (KO) [BR:airr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     138336475  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:airr04131]     138336475   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:airr04147]     138336475    04031 GTP-binding proteins [BR:airr04031]     138336475 Membrane trafficking [BR:airr04131]  Protein recycling   Rab GTPases and associated proteins    Rab GTPases     138336475 Exosome [BR:airr04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    138336475   Exosomal proteins of colorectal cancer cells    138336475 GTP-binding proteins [BR:airr04031]  Small (monomeric) G-proteins   Rab Family    Rab11/25 [OT]     138336475 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU baeRF_family5 Motif Other DBs NCBI-GeneID:  138336475 NCBI-ProteinID:  XP_069142077 LinkDB All DBs Position 12 Genome browser AA seq 113 aa AA seqDB search MRSIQVDGKTIKAQIWDSAGQERYQSITNAYYRGAVGALLVYDIAKQLTFENLERWLKEL RDHVDNNIVIMLVGNKSDLRHLRAVPTDKAKAFAEKNGMSFIETSAHGFILMW NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaggagtatacaagtggatgggaaaactatcaaggcacagatctgggactctgctggt caggagagatatcaatctattactaatgcatactaccgtggagccgtcggggcgttatta gtttatgatatagctaaacaattgacatttgagaatttggaacgatggttgaaagaactt cgggaccatgttgataacaacattgtcatcatgttggtaggcaacaaaagtgacttgcgc catctacgagctgtacctactgacaaagctaaggccttcgcagaaaagaatggtatgtct ttcatagaaacatcagcccatggattcatactaatgtggtaa

DBGET integrated database retrieval system