Alistipes indistinctus: AI2BBH_08580 Help Entry AI2BBH_08580      CDS       T06978                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ait  Alistipes indistinctus Pathway ait01100   Metabolic pathways ait01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ait00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AI2BBH_08580 (acpP)    00074 Mycolic acid biosynthesis     AI2BBH_08580 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AI2BBH_08580 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  BCG53812 LinkDB All DBs Position complement(1116495..1116731) Genome browser AA seq 78 aa AA seqDB search MSDISSKVVDIIVDKLGVDAAEVVPTASFTNDLGADSLDTVELIMEFEKEFEISIPDEDA EKITTVGDAITYISAKKN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagacatttcatcaaaagtagtggacattatcgtggacaaactgggcgttgacgca gcagaggttgttcctaccgccagcttcaccaacgacctgggtgccgattctctggacacc gttgagttgatcatggaattcgagaaagagttcgagatctcgattcctgatgaagatgcc gagaagatcaccaccgtcggcgacgccattacttacatttctgccaagaaaaactaa

DBGET integrated database retrieval system