Alistipes indistinctus: AI2BBH_23700 Help Entry AI2BBH_23700      CDS       T06978                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ait  Alistipes indistinctus Pathway ait00020   Citrate cycle (TCA cycle) ait00720   Other carbon fixation pathways ait01100   Metabolic pathways ait01110   Biosynthesis of secondary metabolites ait01120   Microbial metabolism in diverse environments ait01200   Carbon metabolism ait01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ait00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     AI2BBH_23700   09102 Energy metabolism    00720 Other carbon fixation pathways     AI2BBH_23700 Enzymes [BR:ait01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      AI2BBH_23700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_6 Fer4_10 Fer4_7 Fer4_2 Fer4_9 Fer4_4 Fer4_16 Fer4_15 Fer4_17 Fer4_22 Fer4_13 Fer4_3 Fer4_8 Fer4_18 Motif Other DBs NCBI-ProteinID:  BCG55324 LinkDB All DBs Position complement(2976807..2977037) Genome browser AA seq 76 aa AA seqDB search MAKIKGTVVIDKERCKGCNLCVVACPVQVLALAGEVNGKGYNYSQMVRPDDCIGCASCAI VCPDSCIAVYRQKFEE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctaaaattaaaggcacggtcgtgatcgacaaagagcgatgcaaaggatgcaatctc tgcgtggtggcttgtcccgtgcaggtgctggcgttggccggcgaggtcaacggcaaaggg tacaactattcgcagatggtccgtcccgacgattgtatcggatgtgcgagttgtgcgatc gtatgtcccgacagctgtatcgccgtgtaccgtcagaaattcgaggagtag

DBGET integrated database retrieval system