Alistipes ihumii: NQ491_02290 Help Entry NQ491_02290       CDS       T08511                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism aiu  Alistipes ihumii Pathway aiu00020   Citrate cycle (TCA cycle) aiu00720   Other carbon fixation pathways aiu01100   Metabolic pathways aiu01110   Biosynthesis of secondary metabolites aiu01120   Microbial metabolism in diverse environments aiu01200   Carbon metabolism aiu01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:aiu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     NQ491_02290   09102 Energy metabolism    00720 Other carbon fixation pathways     NQ491_02290 Enzymes [BR:aiu01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      NQ491_02290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_2 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_17 Fer4_3 Fer4_15 Fer4_13 Fer4_8 Fer4_22 Motif Other DBs NCBI-ProteinID:  UWN57627 LinkDB All DBs Position complement(558630..558863) Genome browser AA seq 77 aa AA seqDB search MAKIKGTVVVDAERCKGCELCVVACPMKVLALSGEVNGKGYRFSRMVSPEACTGCASCAS VCPDSCITVYRQKFTEP NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaaagattaaggggacggtcgtagtcgacgccgaacgctgcaagggatgcgagctg tgcgtggtcgcttgtccgatgaaggttctcgcgttgagcggcgaggtcaacggcaagggt tatcgtttctcgcggatggtttcgcccgaggcttgtacgggttgcgcttcttgcgcgagc gtttgtcccgatagttgcattacggtgtacaggcagaagtttacggagccctga

DBGET integrated database retrieval system