Alistipes ihumii: NQ491_07475
Help
Entry
NQ491_07475 CDS
T08511
Symbol
accC
Name
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
KO
K01961
acetyl-CoA carboxylase, biotin carboxylase subunit [EC:
6.4.1.2
6.3.4.14
]
Organism
aiu
Alistipes ihumii
Pathway
aiu00061
Fatty acid biosynthesis
aiu00620
Pyruvate metabolism
aiu00640
Propanoate metabolism
aiu00720
Other carbon fixation pathways
aiu01100
Metabolic pathways
aiu01110
Biosynthesis of secondary metabolites
aiu01120
Microbial metabolism in diverse environments
aiu01200
Carbon metabolism
aiu01212
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:
aiu00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00620 Pyruvate metabolism
NQ491_07475 (accC)
00640 Propanoate metabolism
NQ491_07475 (accC)
09102 Energy metabolism
00720 Other carbon fixation pathways
NQ491_07475 (accC)
09103 Lipid metabolism
00061 Fatty acid biosynthesis
NQ491_07475 (accC)
Enzymes [BR:
aiu01000
]
6. Ligases
6.3 Forming carbon-nitrogen bonds
6.3.4 Other carbon-nitrogen ligases
6.3.4.14 biotin carboxylase
NQ491_07475 (accC)
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.2 acetyl-CoA carboxylase
NQ491_07475 (accC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
ATP-grasp
Dala_Dala_lig_C
RimK
ATP-grasp_3
GARS_A
Motif
Other DBs
NCBI-ProteinID:
UWN56501
UniProt:
A0ABY5UWU5
LinkDB
All DBs
Position
1849496..1851013
Genome browser
AA seq
505 aa
AA seq
DB search
MIKKIVIANRGEIAVRVIRSCREMGISPVALFSEADRLSRHVMLADEAYCIGGAASKESY
LNIDRIIRVALACGADAVHPGYGFLSENADFARRCAEAGLVFIGPRPETIDAMGDKISAR
RKMIEAGVPVVPGTQENLSGADEAVEACRRIGFPVMLKASQGGGGKGMRLARSEDEVREA
FVAARSEAVASFGDGTIYIERFVEEPHHIEFQILGDTHGNVIHLCDRECSVQRRHQKIVE
ESPSPFLTPELRERMGADAVAAARAVGYVGAGTIEFLVDKHRNYYFLEMNTRLQVEHPIT
EEVTGVDLVREQIRIAAGEPLSLAQPDIVQRGHAIECRVCAEDAAAGFMPSPGPVRQLSE
PGGPGVRIDGYVYEGYDIPIHYDPMISKLIVHADTRERAIARMRRALDEYRITGVKTNIG
YLSSILGVPDFERGSYDTSFLEKNAVLLGSAAPQQDERTEDLAMIVAYMNYIVDTESGAG
ATAATAGDQTSRWREFGKRKGVMGM
NT seq
1518 nt
NT seq
+upstream
nt +downstream
nt
atgataaaaaaaatcgtgattgccaaccggggagaaatcgcggtgcgcgtgattcgctcg
tgtcgcgagatgggtatcagcccggtggcgctgttctcggaagccgaccggctgtcgagg
catgtgatgctcgccgacgaggcttattgcatcggcggagccgcctcgaaagagagctac
ctgaacatcgaccggatcatccgcgtggccctggcctgcggagcggacgccgtgcatccc
ggctacggatttctgtcggagaacgccgacttcgcacgccggtgcgccgaggcggggctc
gtgttcatcggcccccggcccgaaacgatcgacgcgatgggagacaagatctcggcccgc
aggaaaatgatcgaggccggcgttccggtcgttccgggcacgcaggagaacctgtccgga
gccgacgaagccgtcgaggcctgccgccgcatcggctttccggtcatgctgaaagcgtcg
cagggcggcggcggcaagggaatgcgtctggcgcggtccgaggacgaggtccgcgaggct
ttcgtggcggcacgctccgaggcggtggcctcgttcggcgacggaacgatctacatcgaa
cgcttcgtcgaagagcctcaccatatcgagttccagattctgggcgatacgcacggaaac
gtgatccacctgtgcgaccgggagtgctcggtacagcgcagacatcagaaaatcgtcgag
gagagcccgtccccgtttctgacgccggaactgcgcgagaggatgggcgccgacgccgtg
gccgcggcccgggccgtcggatacgtcggagcaggcacgatcgagtttctggtggacaag
caccgcaactactattttctggagatgaatacccgtttgcaggtcgagcatccgatcacc
gaggaggtgacgggcgtcgatctggtccgcgagcagatacgcatcgcagcgggcgagccg
ctgtcgctcgcgcagcccgacatcgtgcagcggggccatgcgatcgaatgccgggtctgc
gccgaggatgcggccgccgggttcatgccgtcgccgggtccggtaagacaactatcggaa
cccggaggtccgggcgtacgcatcgacggatacgtctacgaaggatacgatatccctatc
cactacgacccgatgatctccaaactgatcgtgcacgccgacacccgtgagcgagcgatc
gcgcggatgcgccgcgctttggacgagtaccggatcaccggtgtcaaaacgaacatcggc
tacctgagctccattctcggcgtgcccgacttcgagcgcgggtcgtacgacacgtcgttt
ctggaaaagaacgccgtcctgctcggctccgccgctccgcaacaggacgaacgaaccgag
gatctggccatgatcgtggcgtatatgaactatatcgtcgataccgagagcggcgccggc
gcgacggccgcgacggccggcgaccagacgagccggtggcgcgaattcggcaagcgcaag
ggcgtcatgggcatgtaa
DBGET
integrated database retrieval system