Amycolatopsis japonica: AJAP_04700 Help Entry AJAP_04700        CDS       T03225                                  Name (GenBank) Hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism aja  Amycolatopsis japonica Pathway aja03430   Mismatch repair Brite KEGG Orthology (KO) [BR:aja00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     AJAP_04700  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:aja03400]     AJAP_04700 Enzymes [BR:aja01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      AJAP_04700 DNA repair and recombination proteins [BR:aja03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      AJAP_04700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Motif Other DBs NCBI-ProteinID:  AIG73862 UniProt:  A0A075UIH4 LinkDB All DBs Position complement(923284..923505) Genome browser AA seq 73 aa AA seqDB search MSETAELGYEQARDKLVEVVRELEAGGLSLEQSLALWEKGEQLAKVCEHHLEGARERIEA ALSSVEDEAGDGQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt gtgagcgagaccgccgaactcggctacgagcaggcccgcgacaagctggtcgaggtcgtc cgcgaactcgaagcgggcgggctgtccctggaacagtcgctcgccctgtgggagaagggc gagcagctggcgaaggtctgcgagcaccacctcgagggcgcgcgcgagcggatcgaggcc gcgctgtcgtccgtcgaggacgaggccggcgacggtcagtga

DBGET integrated database retrieval system