Anneissia japonica (feather star): 117123778 Help Entry 117123778         CDS       T08613                                  Name (RefSeq) c-Myc-binding protein-like   KO K25550   c-Myc-binding protein Organism ajc  Anneissia japonica (feather star) Brite KEGG Orthology (KO) [BR:ajc00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ajc03037]     117123778 Cilium and associated proteins [BR:ajc03037]  Motile cilia and associated proteins   Sperm associated proteins    117123778 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TSC22 ZapB bZIP_1 Sas-6_C_CC Shugoshin_N bZIP_2 Cnn_1N NUDIX-like DUF6779 YabA DivIC NagJ_C Cep57_CLD_2 Motif Other DBs NCBI-GeneID:  117123778 NCBI-ProteinID:  XP_033125683 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MTTFRPADSKREEFRKYLEKSGVLDTLTRVLVGLYEEPEKPTNALDFLKQHIGKTGPDTA DVEVLRLEVTELRQKVEQLTEENAELRAKLPPEPQDAEQPSES NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgactacatttagaccagcagattcaaagagagaggagttcagaaaataccttgagaag tcaggtgttcttgatacactgacaagagtacttgttggtctttatgaagagcctgaaaaa cccaccaatgcattggactttttgaaacagcacattggcaaaactggaccagacacagct gatgtcgaggttcttaggctggaggtcactgaactacggcaaaaagttgaacagttaaca gaagaaaatgcagagcttagagcaaagttaccaccagaacctcaagatgctgaacagcca agtgaaagctaa

DBGET integrated database retrieval system