Aeromonas jandaei: I6H43_06740 Help Entry I6H43_06740       CDS       T07712                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism ajd  Aeromonas jandaei Pathway ajd02024   Quorum sensing ajd03018   RNA degradation Brite KEGG Orthology (KO) [BR:ajd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     I6H43_06740 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     I6H43_06740 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ajd03019]     I6H43_06740 (hfq)    03036 Chromosome and associated proteins [BR:ajd03036]     I6H43_06740 (hfq) Messenger RNA biogenesis [BR:ajd03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      I6H43_06740 (hfq) Chromosome and associated proteins [BR:ajd03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     I6H43_06740 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QQB21218 UniProt:  A0A2S5FCU8 LinkDB All DBs Position complement(1475253..1475516) Genome browser AA seq 87 aa AA seqDB search MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPARAVNHHQQAAGGAGDEQGDAEA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctctccaagacccgtttttgaatgcgctgcgccgtgagcggatt cctgtttctatctatttggtgaacggcatcaaactgcaaggtcaaatcgaatccttcgac cagtttgtcattctgctgaagaacaccgtgagccagatggtctacaagcacgccatctct accgtggttccggcccgagccgtcaaccatcatcagcaggctgccggtggcgccggtgat gaacagggtgatgccgaggcgtga

DBGET integrated database retrieval system