Aeromonas jandaei: I6H43_15165 Help Entry I6H43_15165       CDS       T07712                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ajd  Aeromonas jandaei Pathway ajd01100   Metabolic pathways ajd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ajd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I6H43_15165    00074 Mycolic acid biosynthesis     I6H43_15165   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I6H43_15165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Phytase Motif Other DBs NCBI-ProteinID:  QQB18879 LinkDB All DBs Position complement(3229951..3230211) Genome browser AA seq 86 aa AA seqDB search MQQTLTEEIKQLIIDSLNLEGMTTADIDTDAPLFNDGLGLDSIDALELGLAIKGRYGIVL SADDENTRRHFASVAALAALVNQQRG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcaacaaacattaactgaagaaatcaaacaactgatcatcgacagcctcaacctcgaa ggcatgacgactgccgatatcgacaccgacgccccgctcttcaatgacggtctcggtctc gactccatcgatgcgctggagctgggactggcgatcaagggacgctacggcatcgtgctc tcggctgatgacgagaatacccgtcgtcactttgcctctgttgcagccctggctgccctc gtcaaccagcagcggggataa

DBGET integrated database retrieval system