KEGG   Aeromonas jandaei: I6H43_17355
Entry
I6H43_17355       CDS       T07712                                 
Symbol
sctD
Name
(GenBank) type III secretion system inner membrane ring subunit SctD
  KO
K03220  type III secretion protein D
Organism
ajd  Aeromonas jandaei
Brite
KEGG Orthology (KO) [BR:ajd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ajd02044]
    I6H43_17355 (sctD)
Secretion system [BR:ajd02044]
 Type III secretion system
  Type III secretion core apparatus
   I6H43_17355 (sctD)
SSDB
Motif
Pfam: Yop-YscD_ppl_2nd Yop-YscD_cpl Yop-YscD_ppl_1st Yop-YscD_ppl_3rd Y4YQ_C T2SSB CdsD_PD2
Other DBs
NCBI-ProteinID: QQB19268
UniProt: A0A7T4DNK9
LinkDB
Position
3680591..3681892
AA seq 433 aa
MSWKCRVYRGLNRGVEVALSEGRLVIGSDPLLADLVLVDEGMAPEHLVLLVSAEGINLQG
WAEGITPTQDGAALEAGAQLMAGTRLEAGPLLWSFCDSSRSLPEQLEALPAMAAPARPRR
RAGSAEWWLVGLCLSLVMAVVVMLGHGWWQGSSESDTARNEQELKRFLAAPAYRQVVLNS
SDPELWLLSGYVDENGNRLALQQYLDGKGLSYRLDLRTMEDLRQGAGFILQKLGYEQLQI
RNGKEPGWLRLSGAISAQDERWNSIESLLKQEVPGLLGIENRVQVAGAHRKRLDAMLQEQ
GLAGLLRVSESRDRIELSGQLDEARLAQFQQLQLQFRREFGSHPMLELINQSRSPRQDEL
EFEVRSVSLGRVPYVTLADNRRYPVGGATANGVRILSIQRDAVVVSKGKQQYIVRLKGGE
SHDDQFGNATVRR
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgagctggaagtgccgcgtatatcgcgggcttaaccgcggggtagaggtagccctgtcg
gaagggcgtctggtcatcggttccgatccgctgctggccgatctggtgctggtggatgag
gggatggcccccgagcatctggtgctgctggtgtcggccgaagggatcaacctgcagggg
tgggctgagggcatcacgccaactcaggatggcgcggcactggaggcaggcgcccagctg
atggcaggtacccggctggaggctggccccctgctctggagtttttgcgacagcagccgg
tcgctgcctgaacagctggaggcgttgcctgccatggcggcaccggcgcgaccacgacgg
cgtgccggcagtgccgagtggtggctggttggcctctgcctgtcgctggtcatggcggtg
gttgtgatgcttggccacggctggtggcaggggagcagcgagagcgataccgctcgcaat
gagcaggagctcaagcgctttctggccgcgccagcctatcgccaggtggtgctcaacagc
agtgaccccgaactctggttgctctcgggatatgtggatgagaacggcaaccgcctcgcc
ctgcagcagtatctcgatggcaaggggctcagctatcgccttgacctgcgcaccatggag
gatctgcgtcagggcgccgggttcatcctgcaaaaactcggttacgagcagttgcagatc
cgcaatggcaaggagcccggctggctgcgcttgagcggagccatcagcgcgcaggatgaa
cgctggaacagcattgaatccctgctcaagcaggaggtgccggggctactcggcatcgaa
aaccgggtgcaggtagccggagcacatcgcaagcgactcgatgccatgttgcaggagcag
gggctggccggtttgctgcgggtgagtgaatcgcgcgaccggatcgagctgtcaggtcag
ctggatgaggcgagattggcgcaatttcagcaactgcagttgcagtttcgccgcgagttc
ggctctcaccccatgctggagctgatcaaccagagccgttcgccccgtcaggatgagctg
gagttcgaggtgcgcagtgtctccctcggcagggtgccctacgtcaccctggccgacaac
cgccgctacccggtcggaggggcgacagccaacggagttcgcatcctctctatccagcgc
gatgcggtggtggtgagcaagggcaagcagcaatacatcgtcagattgaaagggggcgaa
agccatgatgaccagtttggaaacgcgactgtccggcgctga

DBGET integrated database retrieval system