Histoplasma mississippiense: HCAG_01103 Help Entry HCAG_01103        CDS       T02229                                  Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism aje  Histoplasma mississippiense Pathway aje04144   Endocytosis Brite KEGG Orthology (KO) [BR:aje00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     HCAG_01103  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aje04131]     HCAG_01103   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aje04147]     HCAG_01103    04031 GTP-binding proteins [BR:aje04031]     HCAG_01103 Membrane trafficking [BR:aje04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     HCAG_01103   Arf GTPases and associated proteins    Arf GTPases     HCAG_01103 Exosome [BR:aje04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HCAG_01103   Exosomal proteins of colorectal cancer cells    HCAG_01103 GTP-binding proteins [BR:aje04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     HCAG_01103 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf SRPRB GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  5449921 NCBI-ProteinID:  XP_001544057 UniProt:  A6QUP7 LinkDB All DBs AA seq 120 aa AA seqDB search MSGMLVDRTKSALFGDIIFLGLIFVIDSNDRARIDEARQELHRIILDREMKEALLLVFAN KQDIPGAMTPQEVTDKLQLTQLKDKVWFVVPSCATTGEGLFEGLGWLSNNVKSQPQKQIK NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtctgggatgttggtggacaggacaaaatccgccctctttggcgacattatttttctg ggtctcattttcgttattgactcgaacgatcgcgcccgcatcgacgaagcacgccaagag ctccatcggatcatcctggatcgggagatgaaggaggctttgctgctagttttcgcaaat aagcaagatattcccggagctatgaccccccaggaagtcactgacaagctccaattgacc caactcaaggacaaagtgtggtttgttgtcccgagttgtgcaaccacaggcgagggattg tttgagggcctgggctggctctccaacaatgtcaagtcgcaaccgcaaaagcaaatcaaa taa

DBGET integrated database retrieval system