Histoplasma mississippiense: HCAG_05560 Help Entry HCAG_05560        CDS       T02229                                  Name (RefSeq) similar to rho GTPase   KO K04513   Ras homolog gene family, member A Organism aje  Histoplasma mississippiense Pathway aje04011   MAPK signaling pathway - yeast aje04081   Hormone signaling aje04144   Endocytosis aje05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:aje00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     HCAG_05560   09133 Signaling molecules and interaction    04081 Hormone signaling     HCAG_05560  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     HCAG_05560  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     HCAG_05560  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aje04131]     HCAG_05560   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aje04147]     HCAG_05560    04031 GTP-binding proteins [BR:aje04031]     HCAG_05560 Membrane trafficking [BR:aje04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     HCAG_05560 Exosome [BR:aje04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HCAG_05560   Exosomal proteins of other body fluids (saliva and urine)    HCAG_05560   Exosomal proteins of colorectal cancer cells    HCAG_05560   Exosomal proteins of bladder cancer cells    HCAG_05560 GTP-binding proteins [BR:aje04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     HCAG_05560 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Motif Other DBs NCBI-GeneID:  5446359 NCBI-ProteinID:  XP_001540093 UniProt:  A6R7F2 LinkDB All DBs AA seq 192 aa AA seqDB search MAEIRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGKHVELALWDT AGQEDYDRLRPLSYPDSHVILICFAIDSPDSLDNVQEKWISEVLHFCQGHPIILVGCKKD LRHDPRTIAELTKTSQKPVTPEQGEEVRKKIGAYKYLECSARTNDGVREVFESATRAALL AKKDKKSKCRIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggctgagatccgccgtaaacttgtcattgttggggatggtgcatgtgggaagacttgt ctgttgattgttttctccaagggaaccttccctgaggtctatgtcccaactgtttttgag aactacgtggccgatgttgaggtcgatggaaagcatgtcgaactggcactttgggatacg gctggccaggaagattacgaccgtctcagacccctctcgtaccctgattcacatgttatt cttatctgcttcgctattgattcccctgattcgctcgacaacgttcaagaaaagtggatt tctgaggttctacacttctgccaaggccacccaattatcctcgttggctgcaagaaggat ctccgccacgaccccagaaccattgcggagttgactaagacctcccagaagcccgtcacc ccagaacagggtgaggaggtccgcaagaagattggcgcctacaagtacctggaatgctca gcccggacaaatgatggagttcgtgaggtgttcgagtccgctactcgggcagcacttttg gcaaagaaggataagaaatcgaaatgcaggatcttgtaa

DBGET integrated database retrieval system