Histoplasma mississippiense: HCAG_07242 Help Entry HCAG_07242        CDS       T02229                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism aje  Histoplasma mississippiense Pathway aje03060   Protein export aje04141   Protein processing in endoplasmic reticulum aje04145   Phagosome Brite KEGG Orthology (KO) [BR:aje00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     HCAG_07242    04141 Protein processing in endoplasmic reticulum     HCAG_07242  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     HCAG_07242  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aje04131]     HCAG_07242   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:aje02044]     HCAG_07242 Membrane trafficking [BR:aje04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     HCAG_07242 Secretion system [BR:aje02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    HCAG_07242 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  5444085 NCBI-ProteinID:  XP_001537820 UniProt:  A6RC84 LinkDB All DBs AA seq 70 aa AA seqDB search MSDTFQELADIPKDFVKDGMLFMNRCTKPDKREFLKISQAVGFGFLIMGAIGYFIKLIHI PVNNILVGGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtcagacaccttccaggaactcgccgatatccctaaggatttcgtcaaagatggcatg ctcttcatgaaccgatgtacaaagcccgacaagcgtgaattcctcaagatcagccaggca gttggcttcggtttcttgatcatgggagctataggttacttcatcaaactgatacacata ccggtcaacaatattctcgtcggaggtgcatga

DBGET integrated database retrieval system