Acidipropionibacterium jensenii: C0Z10_03855 Help Entry C0Z10_03855       CDS       T05836                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism aji  Acidipropionibacterium jensenii Brite KEGG Orthology (KO) [BR:aji00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aji03032]     C0Z10_03855    03036 Chromosome and associated proteins [BR:aji03036]     C0Z10_03855    03400 DNA repair and recombination proteins [BR:aji03400]     C0Z10_03855 DNA replication proteins [BR:aji03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C0Z10_03855 Chromosome and associated proteins [BR:aji03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C0Z10_03855 DNA repair and recombination proteins [BR:aji03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C0Z10_03855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG COMMD9_N HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 Mnd1 Motif Other DBs NCBI-ProteinID:  AZZ39029 UniProt:  A0A3Q9UCX5 LinkDB All DBs Position complement(856326..856601) Genome browser AA seq 91 aa AA seqDB search MTKSELIKAIAKEASLTETQANEAVKALTDVITTALVNGEKVQLPGLLTAESVERPARNG RNPRTGESMTIPAHKAVKISASSTLKKAVSE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccaagtccgagctcatcaaggccatcgccaaggaggcctcgctcaccgagacccag gccaacgaagctgtcaaggcgctcaccgacgtcatcaccaccgccctggtgaacggcgag aaggttcagcttcccggtctgctcaccgccgagtcggtcgagcgtccggcgcgcaacggg cgcaacccgcgcaccggcgagtcgatgaccatcccggcccacaaggccgtcaagatctcg gcatcgagcaccctcaagaaggccgtctcggagtga

DBGET integrated database retrieval system