Acidipropionibacterium jensenii: C0Z10_07350 Help Entry C0Z10_07350       CDS       T05836                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aji  Acidipropionibacterium jensenii Pathway aji00998   Biosynthesis of various antibiotics aji01100   Metabolic pathways aji01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aji00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C0Z10_07350    00074 Mycolic acid biosynthesis     C0Z10_07350   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C0Z10_07350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  AZZ39596 UniProt:  A0A3S4UPP3 LinkDB All DBs Position 1638197..1638442 Genome browser AA seq 81 aa AA seqDB search MADNAQVLSDIADIVNDITGVDQAEVTPEKSFTDDLDVDSLSMVEIVYACEEKFGIEIPD DKSKDLKTVGDAINFVVAAKA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctgacaacgcacaggtcctctccgacatcgccgacatcgtcaacgacatcaccgga gtcgaccaggccgaggtgaccccggagaagtccttcaccgacgatctggacgtcgactcc ctctcgatggtcgagatcgtctacgcctgcgaggagaagttcggcatcgagatccccgac gacaagtccaaggacctcaagaccgtcggcgacgccatcaacttcgtggtcgcggccaag gcctga

DBGET integrated database retrieval system