KEGG   Artibeus jamaicensis (Jamaican fruit-eating bat): 119041711
Entry
119041711         CDS       T07223                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
ajm  Artibeus jamaicensis (Jamaican fruit-eating bat)
Pathway
ajm01521  EGFR tyrosine kinase inhibitor resistance
ajm01522  Endocrine resistance
ajm04010  MAPK signaling pathway
ajm04012  ErbB signaling pathway
ajm04014  Ras signaling pathway
ajm04015  Rap1 signaling pathway
ajm04062  Chemokine signaling pathway
ajm04068  FoxO signaling pathway
ajm04071  Sphingolipid signaling pathway
ajm04072  Phospholipase D signaling pathway
ajm04137  Mitophagy - animal
ajm04140  Autophagy - animal
ajm04150  mTOR signaling pathway
ajm04151  PI3K-Akt signaling pathway
ajm04210  Apoptosis
ajm04211  Longevity regulating pathway
ajm04213  Longevity regulating pathway - multiple species
ajm04218  Cellular senescence
ajm04360  Axon guidance
ajm04370  VEGF signaling pathway
ajm04371  Apelin signaling pathway
ajm04540  Gap junction
ajm04550  Signaling pathways regulating pluripotency of stem cells
ajm04625  C-type lectin receptor signaling pathway
ajm04650  Natural killer cell mediated cytotoxicity
ajm04660  T cell receptor signaling pathway
ajm04662  B cell receptor signaling pathway
ajm04664  Fc epsilon RI signaling pathway
ajm04714  Thermogenesis
ajm04720  Long-term potentiation
ajm04722  Neurotrophin signaling pathway
ajm04725  Cholinergic synapse
ajm04726  Serotonergic synapse
ajm04730  Long-term depression
ajm04810  Regulation of actin cytoskeleton
ajm04910  Insulin signaling pathway
ajm04912  GnRH signaling pathway
ajm04915  Estrogen signaling pathway
ajm04916  Melanogenesis
ajm04917  Prolactin signaling pathway
ajm04919  Thyroid hormone signaling pathway
ajm04921  Oxytocin signaling pathway
ajm04926  Relaxin signaling pathway
ajm04929  GnRH secretion
ajm04933  AGE-RAGE signaling pathway in diabetic complications
ajm04935  Growth hormone synthesis, secretion and action
ajm05010  Alzheimer disease
ajm05022  Pathways of neurodegeneration - multiple diseases
ajm05034  Alcoholism
ajm05160  Hepatitis C
ajm05161  Hepatitis B
ajm05163  Human cytomegalovirus infection
ajm05165  Human papillomavirus infection
ajm05166  Human T-cell leukemia virus 1 infection
ajm05167  Kaposi sarcoma-associated herpesvirus infection
ajm05170  Human immunodeficiency virus 1 infection
ajm05200  Pathways in cancer
ajm05203  Viral carcinogenesis
ajm05205  Proteoglycans in cancer
ajm05206  MicroRNAs in cancer
ajm05207  Chemical carcinogenesis - receptor activation
ajm05208  Chemical carcinogenesis - reactive oxygen species
ajm05210  Colorectal cancer
ajm05211  Renal cell carcinoma
ajm05213  Endometrial cancer
ajm05214  Glioma
ajm05215  Prostate cancer
ajm05216  Thyroid cancer
ajm05218  Melanoma
ajm05219  Bladder cancer
ajm05220  Chronic myeloid leukemia
ajm05221  Acute myeloid leukemia
ajm05223  Non-small cell lung cancer
ajm05224  Breast cancer
ajm05225  Hepatocellular carcinoma
ajm05226  Gastric cancer
ajm05230  Central carbon metabolism in cancer
ajm05231  Choline metabolism in cancer
ajm05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ajm05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ajm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    119041711 (NRAS)
   04012 ErbB signaling pathway
    119041711 (NRAS)
   04014 Ras signaling pathway
    119041711 (NRAS)
   04015 Rap1 signaling pathway
    119041711 (NRAS)
   04370 VEGF signaling pathway
    119041711 (NRAS)
   04371 Apelin signaling pathway
    119041711 (NRAS)
   04068 FoxO signaling pathway
    119041711 (NRAS)
   04072 Phospholipase D signaling pathway
    119041711 (NRAS)
   04071 Sphingolipid signaling pathway
    119041711 (NRAS)
   04151 PI3K-Akt signaling pathway
    119041711 (NRAS)
   04150 mTOR signaling pathway
    119041711 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    119041711 (NRAS)
   04137 Mitophagy - animal
    119041711 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    119041711 (NRAS)
   04218 Cellular senescence
    119041711 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    119041711 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    119041711 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    119041711 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    119041711 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    119041711 (NRAS)
   04660 T cell receptor signaling pathway
    119041711 (NRAS)
   04662 B cell receptor signaling pathway
    119041711 (NRAS)
   04664 Fc epsilon RI signaling pathway
    119041711 (NRAS)
   04062 Chemokine signaling pathway
    119041711 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    119041711 (NRAS)
   04929 GnRH secretion
    119041711 (NRAS)
   04912 GnRH signaling pathway
    119041711 (NRAS)
   04915 Estrogen signaling pathway
    119041711 (NRAS)
   04917 Prolactin signaling pathway
    119041711 (NRAS)
   04921 Oxytocin signaling pathway
    119041711 (NRAS)
   04926 Relaxin signaling pathway
    119041711 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    119041711 (NRAS)
   04919 Thyroid hormone signaling pathway
    119041711 (NRAS)
   04916 Melanogenesis
    119041711 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    119041711 (NRAS)
   04726 Serotonergic synapse
    119041711 (NRAS)
   04720 Long-term potentiation
    119041711 (NRAS)
   04730 Long-term depression
    119041711 (NRAS)
   04722 Neurotrophin signaling pathway
    119041711 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    119041711 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    119041711 (NRAS)
   04213 Longevity regulating pathway - multiple species
    119041711 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    119041711 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    119041711 (NRAS)
   05206 MicroRNAs in cancer
    119041711 (NRAS)
   05205 Proteoglycans in cancer
    119041711 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    119041711 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    119041711 (NRAS)
   05203 Viral carcinogenesis
    119041711 (NRAS)
   05230 Central carbon metabolism in cancer
    119041711 (NRAS)
   05231 Choline metabolism in cancer
    119041711 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    119041711 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    119041711 (NRAS)
   05225 Hepatocellular carcinoma
    119041711 (NRAS)
   05226 Gastric cancer
    119041711 (NRAS)
   05214 Glioma
    119041711 (NRAS)
   05216 Thyroid cancer
    119041711 (NRAS)
   05221 Acute myeloid leukemia
    119041711 (NRAS)
   05220 Chronic myeloid leukemia
    119041711 (NRAS)
   05218 Melanoma
    119041711 (NRAS)
   05211 Renal cell carcinoma
    119041711 (NRAS)
   05219 Bladder cancer
    119041711 (NRAS)
   05215 Prostate cancer
    119041711 (NRAS)
   05213 Endometrial cancer
    119041711 (NRAS)
   05224 Breast cancer
    119041711 (NRAS)
   05223 Non-small cell lung cancer
    119041711 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    119041711 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    119041711 (NRAS)
   05161 Hepatitis B
    119041711 (NRAS)
   05160 Hepatitis C
    119041711 (NRAS)
   05163 Human cytomegalovirus infection
    119041711 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    119041711 (NRAS)
   05165 Human papillomavirus infection
    119041711 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    119041711 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    119041711 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    119041711 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    119041711 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    119041711 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    119041711 (NRAS)
   01522 Endocrine resistance
    119041711 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ajm04131]
    119041711 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ajm04147]
    119041711 (NRAS)
   04031 GTP-binding proteins [BR:ajm04031]
    119041711 (NRAS)
Membrane trafficking [BR:ajm04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    119041711 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    119041711 (NRAS)
Exosome [BR:ajm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   119041711 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   119041711 (NRAS)
  Exosomal proteins of breast cancer cells
   119041711 (NRAS)
  Exosomal proteins of colorectal cancer cells
   119041711 (NRAS)
GTP-binding proteins [BR:ajm04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    119041711 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 119041711
NCBI-ProteinID: XP_036990979
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLSSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgaccccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgctggacatactggacacagctgga
caagaggagtacagtgccatgcgagaccagtacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcattcgcagatattaacctgtacagagaacagatt
aagcgagtcaaagactccgatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccaacaagaacagttgacacaaaacaagcccacgaactggccaagagttacgggatccca
ttcattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggtg
agggaaatacgccagtaccgaatgaaaaaactcagcagcagtgatgacgggacccagggt
tgcatggggctgccctgtgtggtgatgtaa

DBGET integrated database retrieval system