KEGG   Artibeus jamaicensis (Jamaican fruit-eating bat): 119057312
Entry
119057312         CDS       T07223                                 
Name
(RefSeq) calmodulin-alpha-like
  KO
K02183  calmodulin
Organism
ajm  Artibeus jamaicensis (Jamaican fruit-eating bat)
Pathway
ajm04014  Ras signaling pathway
ajm04015  Rap1 signaling pathway
ajm04020  Calcium signaling pathway
ajm04022  cGMP-PKG signaling pathway
ajm04024  cAMP signaling pathway
ajm04070  Phosphatidylinositol signaling system
ajm04114  Oocyte meiosis
ajm04218  Cellular senescence
ajm04261  Adrenergic signaling in cardiomyocytes
ajm04270  Vascular smooth muscle contraction
ajm04371  Apelin signaling pathway
ajm04625  C-type lectin receptor signaling pathway
ajm04713  Circadian entrainment
ajm04720  Long-term potentiation
ajm04722  Neurotrophin signaling pathway
ajm04728  Dopaminergic synapse
ajm04740  Olfactory transduction
ajm04744  Phototransduction
ajm04750  Inflammatory mediator regulation of TRP channels
ajm04910  Insulin signaling pathway
ajm04912  GnRH signaling pathway
ajm04915  Estrogen signaling pathway
ajm04916  Melanogenesis
ajm04921  Oxytocin signaling pathway
ajm04922  Glucagon signaling pathway
ajm04924  Renin secretion
ajm04925  Aldosterone synthesis and secretion
ajm04970  Salivary secretion
ajm04971  Gastric acid secretion
ajm05010  Alzheimer disease
ajm05012  Parkinson disease
ajm05022  Pathways of neurodegeneration - multiple diseases
ajm05031  Amphetamine addiction
ajm05034  Alcoholism
ajm05133  Pertussis
ajm05152  Tuberculosis
ajm05163  Human cytomegalovirus infection
ajm05167  Kaposi sarcoma-associated herpesvirus infection
ajm05170  Human immunodeficiency virus 1 infection
ajm05200  Pathways in cancer
ajm05214  Glioma
ajm05417  Lipid and atherosclerosis
ajm05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ajm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    119057312
   04015 Rap1 signaling pathway
    119057312
   04371 Apelin signaling pathway
    119057312
   04020 Calcium signaling pathway
    119057312
   04070 Phosphatidylinositol signaling system
    119057312
   04024 cAMP signaling pathway
    119057312
   04022 cGMP-PKG signaling pathway
    119057312
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    119057312
   04218 Cellular senescence
    119057312
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    119057312
  09152 Endocrine system
   04910 Insulin signaling pathway
    119057312
   04922 Glucagon signaling pathway
    119057312
   04912 GnRH signaling pathway
    119057312
   04915 Estrogen signaling pathway
    119057312
   04921 Oxytocin signaling pathway
    119057312
   04916 Melanogenesis
    119057312
   04924 Renin secretion
    119057312
   04925 Aldosterone synthesis and secretion
    119057312
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    119057312
   04270 Vascular smooth muscle contraction
    119057312
  09154 Digestive system
   04970 Salivary secretion
    119057312
   04971 Gastric acid secretion
    119057312
  09156 Nervous system
   04728 Dopaminergic synapse
    119057312
   04720 Long-term potentiation
    119057312
   04722 Neurotrophin signaling pathway
    119057312
  09157 Sensory system
   04744 Phototransduction
    119057312
   04740 Olfactory transduction
    119057312
   04750 Inflammatory mediator regulation of TRP channels
    119057312
  09159 Environmental adaptation
   04713 Circadian entrainment
    119057312
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    119057312
  09162 Cancer: specific types
   05214 Glioma
    119057312
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    119057312
   05163 Human cytomegalovirus infection
    119057312
   05167 Kaposi sarcoma-associated herpesvirus infection
    119057312
  09171 Infectious disease: bacterial
   05133 Pertussis
    119057312
   05152 Tuberculosis
    119057312
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    119057312
   05012 Parkinson disease
    119057312
   05022 Pathways of neurodegeneration - multiple diseases
    119057312
  09165 Substance dependence
   05031 Amphetamine addiction
    119057312
   05034 Alcoholism
    119057312
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    119057312
   05418 Fluid shear stress and atherosclerosis
    119057312
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ajm01009]
    119057312
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ajm04131]
    119057312
   03036 Chromosome and associated proteins [BR:ajm03036]
    119057312
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ajm04147]
    119057312
Protein phosphatases and associated proteins [BR:ajm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     119057312
Membrane trafficking [BR:ajm04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    119057312
Chromosome and associated proteins [BR:ajm03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     119057312
Exosome [BR:ajm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   119057312
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF_EFCAB10_C EH SPARC_Ca_bdg Dockerin_1 Temptin_C UPF0154 EF-hand_11 DUF5580_M SCO1-SenC RNB
Other DBs
NCBI-GeneID: 119057312
NCBI-ProteinID: XP_037011906
LinkDB
Position
Unknown
AA seq 149 aa
MAEELSEEQVAEFKAAFTRFDKNKDGTINVQELGDVMKTLGQNPSEDELKNIIAQVDTDG
DGAISFPEFLAAMVKRMKSWGGEQDLKEVFQAFDLDGDGHITIDELKQAMVRLGQKLTQE
DLEAMIQEADLDKDGQVNYEEFSRILGQK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcagaggagctgtctgaagagcaggtggctgagttcaaggcggccttcaccaggttc
gacaagaacaaggatggcaccatcaacgtgcaggagctgggggatgtcatgaagacccta
ggccagaacccatcagaggacgagctgaagaatatcatcgcccaggtggacacggatggt
gacggcgccatcagcttcccggagttcctggcagcgatggttaagaggatgaagtcctgg
ggcggtgagcaggacctgaaggaggtgttccaagccttcgacctggatggggatggccat
atcaccattgacgagctgaaacaggccatggtccggttggggcagaagctcacccaggaa
gatctggaggccatgatccaggaggcggacctggacaaggatggacaggtgaactatgag
gagttctcgcgcatcctcggtcagaagtga

DBGET integrated database retrieval system