KEGG   Artibeus jamaicensis (Jamaican fruit-eating bat): 119059157
Entry
119059157         CDS       T07223                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ajm  Artibeus jamaicensis (Jamaican fruit-eating bat)
Pathway
ajm01521  EGFR tyrosine kinase inhibitor resistance
ajm01522  Endocrine resistance
ajm01524  Platinum drug resistance
ajm04010  MAPK signaling pathway
ajm04012  ErbB signaling pathway
ajm04014  Ras signaling pathway
ajm04015  Rap1 signaling pathway
ajm04022  cGMP-PKG signaling pathway
ajm04024  cAMP signaling pathway
ajm04062  Chemokine signaling pathway
ajm04066  HIF-1 signaling pathway
ajm04068  FoxO signaling pathway
ajm04071  Sphingolipid signaling pathway
ajm04072  Phospholipase D signaling pathway
ajm04114  Oocyte meiosis
ajm04140  Autophagy - animal
ajm04148  Efferocytosis
ajm04150  mTOR signaling pathway
ajm04151  PI3K-Akt signaling pathway
ajm04210  Apoptosis
ajm04218  Cellular senescence
ajm04261  Adrenergic signaling in cardiomyocytes
ajm04270  Vascular smooth muscle contraction
ajm04350  TGF-beta signaling pathway
ajm04360  Axon guidance
ajm04370  VEGF signaling pathway
ajm04371  Apelin signaling pathway
ajm04380  Osteoclast differentiation
ajm04510  Focal adhesion
ajm04520  Adherens junction
ajm04540  Gap junction
ajm04550  Signaling pathways regulating pluripotency of stem cells
ajm04611  Platelet activation
ajm04613  Neutrophil extracellular trap formation
ajm04620  Toll-like receptor signaling pathway
ajm04621  NOD-like receptor signaling pathway
ajm04625  C-type lectin receptor signaling pathway
ajm04650  Natural killer cell mediated cytotoxicity
ajm04657  IL-17 signaling pathway
ajm04658  Th1 and Th2 cell differentiation
ajm04659  Th17 cell differentiation
ajm04660  T cell receptor signaling pathway
ajm04662  B cell receptor signaling pathway
ajm04664  Fc epsilon RI signaling pathway
ajm04666  Fc gamma R-mediated phagocytosis
ajm04668  TNF signaling pathway
ajm04713  Circadian entrainment
ajm04720  Long-term potentiation
ajm04722  Neurotrophin signaling pathway
ajm04723  Retrograde endocannabinoid signaling
ajm04724  Glutamatergic synapse
ajm04725  Cholinergic synapse
ajm04726  Serotonergic synapse
ajm04730  Long-term depression
ajm04810  Regulation of actin cytoskeleton
ajm04910  Insulin signaling pathway
ajm04912  GnRH signaling pathway
ajm04914  Progesterone-mediated oocyte maturation
ajm04915  Estrogen signaling pathway
ajm04916  Melanogenesis
ajm04917  Prolactin signaling pathway
ajm04919  Thyroid hormone signaling pathway
ajm04921  Oxytocin signaling pathway
ajm04926  Relaxin signaling pathway
ajm04928  Parathyroid hormone synthesis, secretion and action
ajm04929  GnRH secretion
ajm04930  Type II diabetes mellitus
ajm04933  AGE-RAGE signaling pathway in diabetic complications
ajm04934  Cushing syndrome
ajm04935  Growth hormone synthesis, secretion and action
ajm04960  Aldosterone-regulated sodium reabsorption
ajm05010  Alzheimer disease
ajm05020  Prion disease
ajm05022  Pathways of neurodegeneration - multiple diseases
ajm05034  Alcoholism
ajm05132  Salmonella infection
ajm05133  Pertussis
ajm05135  Yersinia infection
ajm05140  Leishmaniasis
ajm05142  Chagas disease
ajm05145  Toxoplasmosis
ajm05152  Tuberculosis
ajm05160  Hepatitis C
ajm05161  Hepatitis B
ajm05163  Human cytomegalovirus infection
ajm05164  Influenza A
ajm05165  Human papillomavirus infection
ajm05166  Human T-cell leukemia virus 1 infection
ajm05167  Kaposi sarcoma-associated herpesvirus infection
ajm05170  Human immunodeficiency virus 1 infection
ajm05171  Coronavirus disease - COVID-19
ajm05200  Pathways in cancer
ajm05203  Viral carcinogenesis
ajm05205  Proteoglycans in cancer
ajm05206  MicroRNAs in cancer
ajm05207  Chemical carcinogenesis - receptor activation
ajm05208  Chemical carcinogenesis - reactive oxygen species
ajm05210  Colorectal cancer
ajm05211  Renal cell carcinoma
ajm05212  Pancreatic cancer
ajm05213  Endometrial cancer
ajm05214  Glioma
ajm05215  Prostate cancer
ajm05216  Thyroid cancer
ajm05218  Melanoma
ajm05219  Bladder cancer
ajm05220  Chronic myeloid leukemia
ajm05221  Acute myeloid leukemia
ajm05223  Non-small cell lung cancer
ajm05224  Breast cancer
ajm05225  Hepatocellular carcinoma
ajm05226  Gastric cancer
ajm05230  Central carbon metabolism in cancer
ajm05231  Choline metabolism in cancer
ajm05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ajm05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ajm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    119059157 (MAPK1)
   04012 ErbB signaling pathway
    119059157 (MAPK1)
   04014 Ras signaling pathway
    119059157 (MAPK1)
   04015 Rap1 signaling pathway
    119059157 (MAPK1)
   04350 TGF-beta signaling pathway
    119059157 (MAPK1)
   04370 VEGF signaling pathway
    119059157 (MAPK1)
   04371 Apelin signaling pathway
    119059157 (MAPK1)
   04668 TNF signaling pathway
    119059157 (MAPK1)
   04066 HIF-1 signaling pathway
    119059157 (MAPK1)
   04068 FoxO signaling pathway
    119059157 (MAPK1)
   04072 Phospholipase D signaling pathway
    119059157 (MAPK1)
   04071 Sphingolipid signaling pathway
    119059157 (MAPK1)
   04024 cAMP signaling pathway
    119059157 (MAPK1)
   04022 cGMP-PKG signaling pathway
    119059157 (MAPK1)
   04151 PI3K-Akt signaling pathway
    119059157 (MAPK1)
   04150 mTOR signaling pathway
    119059157 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    119059157 (MAPK1)
   04148 Efferocytosis
    119059157 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    119059157 (MAPK1)
   04210 Apoptosis
    119059157 (MAPK1)
   04218 Cellular senescence
    119059157 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    119059157 (MAPK1)
   04520 Adherens junction
    119059157 (MAPK1)
   04540 Gap junction
    119059157 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    119059157 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    119059157 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    119059157 (MAPK1)
   04613 Neutrophil extracellular trap formation
    119059157 (MAPK1)
   04620 Toll-like receptor signaling pathway
    119059157 (MAPK1)
   04621 NOD-like receptor signaling pathway
    119059157 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    119059157 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    119059157 (MAPK1)
   04660 T cell receptor signaling pathway
    119059157 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    119059157 (MAPK1)
   04659 Th17 cell differentiation
    119059157 (MAPK1)
   04657 IL-17 signaling pathway
    119059157 (MAPK1)
   04662 B cell receptor signaling pathway
    119059157 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    119059157 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    119059157 (MAPK1)
   04062 Chemokine signaling pathway
    119059157 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    119059157 (MAPK1)
   04929 GnRH secretion
    119059157 (MAPK1)
   04912 GnRH signaling pathway
    119059157 (MAPK1)
   04915 Estrogen signaling pathway
    119059157 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    119059157 (MAPK1)
   04917 Prolactin signaling pathway
    119059157 (MAPK1)
   04921 Oxytocin signaling pathway
    119059157 (MAPK1)
   04926 Relaxin signaling pathway
    119059157 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    119059157 (MAPK1)
   04919 Thyroid hormone signaling pathway
    119059157 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    119059157 (MAPK1)
   04916 Melanogenesis
    119059157 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    119059157 (MAPK1)
   04270 Vascular smooth muscle contraction
    119059157 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    119059157 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    119059157 (MAPK1)
   04725 Cholinergic synapse
    119059157 (MAPK1)
   04726 Serotonergic synapse
    119059157 (MAPK1)
   04720 Long-term potentiation
    119059157 (MAPK1)
   04730 Long-term depression
    119059157 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    119059157 (MAPK1)
   04722 Neurotrophin signaling pathway
    119059157 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    119059157 (MAPK1)
   04380 Osteoclast differentiation
    119059157 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    119059157 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    119059157 (MAPK1)
   05206 MicroRNAs in cancer
    119059157 (MAPK1)
   05205 Proteoglycans in cancer
    119059157 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    119059157 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    119059157 (MAPK1)
   05203 Viral carcinogenesis
    119059157 (MAPK1)
   05230 Central carbon metabolism in cancer
    119059157 (MAPK1)
   05231 Choline metabolism in cancer
    119059157 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    119059157 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    119059157 (MAPK1)
   05212 Pancreatic cancer
    119059157 (MAPK1)
   05225 Hepatocellular carcinoma
    119059157 (MAPK1)
   05226 Gastric cancer
    119059157 (MAPK1)
   05214 Glioma
    119059157 (MAPK1)
   05216 Thyroid cancer
    119059157 (MAPK1)
   05221 Acute myeloid leukemia
    119059157 (MAPK1)
   05220 Chronic myeloid leukemia
    119059157 (MAPK1)
   05218 Melanoma
    119059157 (MAPK1)
   05211 Renal cell carcinoma
    119059157 (MAPK1)
   05219 Bladder cancer
    119059157 (MAPK1)
   05215 Prostate cancer
    119059157 (MAPK1)
   05213 Endometrial cancer
    119059157 (MAPK1)
   05224 Breast cancer
    119059157 (MAPK1)
   05223 Non-small cell lung cancer
    119059157 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    119059157 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    119059157 (MAPK1)
   05161 Hepatitis B
    119059157 (MAPK1)
   05160 Hepatitis C
    119059157 (MAPK1)
   05171 Coronavirus disease - COVID-19
    119059157 (MAPK1)
   05164 Influenza A
    119059157 (MAPK1)
   05163 Human cytomegalovirus infection
    119059157 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    119059157 (MAPK1)
   05165 Human papillomavirus infection
    119059157 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    119059157 (MAPK1)
   05135 Yersinia infection
    119059157 (MAPK1)
   05133 Pertussis
    119059157 (MAPK1)
   05152 Tuberculosis
    119059157 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    119059157 (MAPK1)
   05140 Leishmaniasis
    119059157 (MAPK1)
   05142 Chagas disease
    119059157 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    119059157 (MAPK1)
   05020 Prion disease
    119059157 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    119059157 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    119059157 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    119059157 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    119059157 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    119059157 (MAPK1)
   04934 Cushing syndrome
    119059157 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    119059157 (MAPK1)
   01524 Platinum drug resistance
    119059157 (MAPK1)
   01522 Endocrine resistance
    119059157 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ajm01001]
    119059157 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ajm03036]
    119059157 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ajm04147]
    119059157 (MAPK1)
Enzymes [BR:ajm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     119059157 (MAPK1)
Protein kinases [BR:ajm01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   119059157 (MAPK1)
Chromosome and associated proteins [BR:ajm03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     119059157 (MAPK1)
Exosome [BR:ajm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   119059157 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 119059157
NCBI-ProteinID: XP_037014619
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgat
gtggggccgcgctacaccaatctctcttatattggcgagggcgcctacggcatggtgtgc
tctgcttatgacaatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacattattggtatcaatgatatcattcgagcgccaaccattgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttgaagtatatc
cattcagcaaacgtactgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgcgatctcaagatatgtgattttggcttggcacgcgttgcagatccagaccatgatcac
acaggcttcctgacggagtacgtagccacccgttggtacagggctccagaaattatgttg
aattccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagag
atgctatccaacaggcccatctttccggggaagcattatctcgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagatctgaactgcataatcaatttaaaagct
agaaactatttactttctctcccgcacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggatttactggacaaaatgttgaccttcaaccctcacaag
aggattgaagtggaacaggcactggcccacccatatctggagcagtattatgacccaagt
gatgagcccatcgctgaagcaccattcaagtttgacatggaattggatgacttgcctaag
gagaagctcaaagaactcatttttgaagagactgctagattccagccaggatacagatct
taa

DBGET integrated database retrieval system