KEGG   Artibeus jamaicensis (Jamaican fruit-eating bat): 119061063
Entry
119061063         CDS       T07223                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
ajm  Artibeus jamaicensis (Jamaican fruit-eating bat)
Pathway
ajm04927  Cortisol synthesis and secretion
ajm04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ajm00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    119061063
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    119061063
SSDB
Motif
Pfam: MRAP
Other DBs
NCBI-GeneID: 119061063
NCBI-ProteinID: XP_037017373
LinkDB
Position
Unknown
AA seq 173 aa
MVDGTNASAPNYSYEYYLGYLDPDPVDERKLGAHKHAIAIAVWVGLAAFLLLLLLTLLCV
SWSGSQPARNHARHQPACPWGLRLDLPLRVLRHLLLHRAPQGTPQAPPRSIKEPQQSRRE
GPAPSIPIAPQAHAALLWERALGGDPMASADVGHKPSWPPPGDGTDASNHGHC
NT seq 522 nt   +upstreamnt  +downstreamnt
atggtcgatggcaccaacgcctcggccccgaactacagctacgagtactacctgggctac
ctggaccctgaccccgtggacgagaggaagctgggagcccacaaacatgccatcgccatc
gccgtctgggtgggcctggcggccttcctgctgctcctgctcctcaccctgctgtgcgtg
tcctggtcaggctcccagccggcgcggaaccacgcccggcaccagcccgcctgcccctgg
ggtctccgcctggacctccccctccgcgtcctgaggcacctgctgctccacagggccccc
caggggaccccgcaggccccgcccagatccatcaaggagccacagcagtccaggcgggag
ggccccgccccctccatccccattgccccccaggcccacgctgctctcctgtgggaacgg
gccctcggtggggaccccatggcatcagctgacgtcggccacaagcccagctggccaccc
cctggagatggaacagacgccagcaaccacggccactgctga

DBGET integrated database retrieval system