Acinetobacter johnsonii: RZ95_18250 Help Entry RZ95_18250        CDS       T04178                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism ajo  Acinetobacter johnsonii Brite KEGG Orthology (KO) [BR:ajo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ajo03110]     RZ95_18250 Chaperones and folding catalysts [BR:ajo03110]  Protein folding catalysts   Protein disulfide isomerase    RZ95_18250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Thioredoxin_3 GST_N GST_N_2 Glrx-like Thioredoxin_2 AhpC-TSA_2 Hanta_Gn-B Motif Other DBs NCBI-ProteinID:  ALV74940 LinkDB All DBs Position pXBB1-9:229915..230151 Genome browser AA seq 78 aa AA seqDB search MKELKNVVIYTKDHCPFSKRVKEYLTSEKVDFKQIRVDDDPKTYDELKKKTNLQTVPQVF VDGKFIGSATDFFAWIDS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgaaagaacttaagaacgttgtcatctacacaaaagaccattgtccgtttagtaaacgc gtgaaggagtacttaacttctgaaaaagttgattttaaacaaattcgcgtggatgacgat cccaagacttatgatgagttgaagaaaaaaaccaaccttcaaactgttccgcaagttttt gtggatggaaaattcattggtagcgcgactgacttcttcgcgtggattgatagctaa

DBGET integrated database retrieval system