Acinetobacter johnsonii: RZ95_18260 Help Entry RZ95_18260        CDS       T04178                                  Name (GenBank) hypothetical protein   KO K00537   arsenate reductase (glutaredoxin) [EC:1.20.4.1] Organism ajo  Acinetobacter johnsonii Brite KEGG Orthology (KO) [BR:ajo00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     RZ95_18260 Enzymes [BR:ajo01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.1  arsenate reductase (glutathione/glutaredoxin)      RZ95_18260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Motif Other DBs NCBI-ProteinID:  ALV74779 LinkDB All DBs Position pXBB1-9:230633..230890 Genome browser AA seq 85 aa AA seqDB search MEGVVGIKLFGHKDCHKTKIYQSYLKEKGIEFDFLDVHEDDAAADELRSLYTTGKLNFPT ILVGTKKLRNPKFKDLDKWLEASIK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggagggggtcgtggggattaagctgttcggtcataaggactgccacaaaaccaagatt taccagtcgtacttgaaagaaaaaggaatcgagtttgattttttagatgttcacgaagac gacgcggcagctgatgaactgcgatccctttatactactggaaagttaaatttcccgaca atactggttgggacaaagaagctgagaaaccccaagttcaaggatctcgacaagtggttg gaagcttcgataaaataa

DBGET integrated database retrieval system