Arthrobacter jinronghuae: N2K98_10920 Help Entry N2K98_10920       CDS       T09565                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ajr  Arthrobacter jinronghuae Pathway ajr00998   Biosynthesis of various antibiotics ajr01100   Metabolic pathways ajr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ajr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N2K98_10920    00074 Mycolic acid biosynthesis     N2K98_10920   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N2K98_10920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Ag332 Motif Other DBs NCBI-ProteinID:  UWX77502 LinkDB All DBs Position 2329776..2330021 Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNEETGLAPEAVELDKSFTDDLDIDSISMMTIVVNAEEKFGVRIPD EEVKNLKTVGDAVDFISNAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagaaatcctggccggcctcgccgagatcgtcaatgaagagacgggt ctggcccccgaggccgttgagctggacaagtccttcaccgatgacctggacatcgactcc atttccatgatgaccatcgtcgtcaacgccgaagagaagttcggcgtgcgcatcccggac gaagaggtcaagaacctgaagaccgtcggcgacgccgtggacttcatctccaacgcccag gcttaa

DBGET integrated database retrieval system