KEGG   Acidovorax sp. JS42: Ajs_1690
Entry
Ajs_1690          CDS       T00455                                 
Name
(GenBank) ABC transporter related protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
ajs  Acidovorax sp. JS42
Pathway
ajs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ajs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Ajs_1690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ajs02000]
    Ajs_1690
Enzymes [BR:ajs01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     Ajs_1690
Transporters [BR:ajs02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    Ajs_1690
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_22 AAA_16 AAA_30 RsgA_GTPase AAA_29 Mg_chelatase MobB TubC_N AAA_28 TsaE AAA_23 AAA_24 MeaB MMR_HSR1 AAA_33
Other DBs
NCBI-ProteinID: ABM41881
LinkDB
Position
complement(1757206..1758039)
AA seq 277 aa
MSFELDGVDLCHPGGHVALRGITLAARQGESLALIGPSGAGKTTLLNLLGTALPASAGRV
HVLGSALGASSPDTPHASWPPPRALRARIGTVHQAPPLPPRQRVVTAVLAGRLGQWPAWK
ALASLLYPADLPGAHAALQRVQLQDKLFARCDQLSGGQLQRVGIARVLYQQPALLLADEP
VSALDPTLALATVQLLVQDAAARGATLVASLHAVDLALACFARVVGLREGRIAFDLPAGA
VTPDLLQALYAPPGDGALAPDETPTPPPTTSSYASCR
NT seq 834 nt   +upstreamnt  +downstreamnt
atgagcttcgagctggacggcgtggatctatgccaccccggcggccatgtggcgctgcgc
ggcatcaccctggccgcgcgccagggcgagagcctggcgctgatcggcccctcgggggcg
ggcaagaccaccctgctgaacctgctgggcacagccctgcccgccagcgccggccgcgtg
cacgtgctgggctccgccctgggcgcgtcgtcgcccgacacgccccatgcttcgtggcct
ccgccgcgtgcgctgcgcgcgcgcatcggcaccgtgcaccaggccccgcccctgccaccg
cgccagcgcgtggtgaccgccgtgctggccgggcgcctgggccaatggcccgcatggaag
gcgctggcctcgctgctgtacccggccgacctgcccggtgcgcacgccgcgctgcagcgc
gtgcagttgcaggacaagctgttcgcgcgctgcgaccagctctcgggcgggcagctgcag
cgcgtgggcattgcccgcgtgctgtaccagcagccagcgctgctgctggccgacgagccc
gtctctgccctcgaccccacgctggcgctggccaccgtgcagctgctggtgcaggacgcg
gccgcacgtggcgccacgctggtcgccagcctgcacgcggtggacctggcgctggcctgc
tttgcgcgcgtggtgggcctgcgcgaggggcgcatcgccttcgacctgccggccggcgcg
gtcacgcccgatctgctgcaggcgctgtacgccccgcccggcgacggcgcgctcgcgccg
gatgaaacgcccacgccgcccccgaccaccagcagctacgcatcatgccgttga

DBGET integrated database retrieval system