Acidovorax sp. JS42: Ajs_3503 Help Entry Ajs_3503          CDS       T00455                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism ajs  Acidovorax sp. JS42 Brite KEGG Orthology (KO) [BR:ajs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ajs03110]     Ajs_3503 Chaperones and folding catalysts [BR:ajs03110]  Protein folding catalysts   Protein disulfide isomerase    Ajs_3503 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  ABM43616 UniProt:  A0A9J9FX99 LinkDB All DBs Position complement(3699781..3700038) Genome browser AA seq 85 aa AA seqDB search MQAVKMYTTAVCPYCIRAKQLLKLKGVEQIEEIRVDTDPAARQHMMEITGRRTVPQIFIG DTHVGGHDDLVALDSRGGLVPLLGA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagccgtgaagatgtacaccaccgccgtgtgcccctattgcatccgcgccaagcaa ttgctgaagctgaagggtgtggagcagatcgaggaaatccgcgtggacaccgaccccgcc gcgcgccagcacatgatggagatcaccggccggcgcaccgtcccgcagatcttcattggt gacacccacgtcggcggacacgacgacctcgtggccctggacagccgtggcggtctggtg ccgctgctgggcgcctga

DBGET integrated database retrieval system