Acinonyx jubatus (cheetah): 106968038 Help Entry 106968038         CDS       T04657                                  Name (RefSeq) somatostatin   KO K05237   somatostatin Organism aju  Acinonyx jubatus (cheetah) Pathway aju04024   cAMP signaling pathway aju04080   Neuroactive ligand-receptor interaction aju04081   Hormone signaling aju04935   Growth hormone synthesis, secretion and action aju04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     106968038   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     106968038    04081 Hormone signaling     106968038  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     106968038   09154 Digestive system    04971 Gastric acid secretion     106968038  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aju04052]     106968038 Cytokines and neuropeptides [BR:aju04052]  Neuropeptides   GPCR binding    106968038 SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  106968038 NCBI-ProteinID:  XP_014919876 UniProt:  A0A6I9ZEP3 LinkDB All DBs Position 5 Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSTNSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctgtccatcgtcctggctctgggc ggtgtcaccggcgcgccctccgatcctcgactccgtcagtttctgcagaagtccctggct gctgccgcggggaagcaggaactggccaagtacttcttggcggagctgctgtctgaaccc aaccagacagagaacgatgccctggaacccgaagacttgtcccaggcggctgagcaggat gaaatgaggctggaactgcagagatccactaactcaaaccctgccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacttcctgttag

DBGET integrated database retrieval system