Acinonyx jubatus (cheetah): 106968366 Help Entry 106968366         CDS       T04657                                  Symbol ELOC Name (RefSeq) elongin-C isoform X1   KO K03872   elongin-C Organism aju  Acinonyx jubatus (cheetah) Pathway aju04066   HIF-1 signaling pathway aju04120   Ubiquitin mediated proteolysis aju05170   Human immunodeficiency virus 1 infection aju05200   Pathways in cancer aju05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:aju00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     106968366 (ELOC)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     106968366 (ELOC)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106968366 (ELOC)   09162 Cancer: specific types    05211 Renal cell carcinoma     106968366 (ELOC)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     106968366 (ELOC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:aju04121]     106968366 (ELOC)    03400 DNA repair and recombination proteins [BR:aju03400]     106968366 (ELOC) Ubiquitin system [BR:aju04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      106968366 (ELOC)    Cul5 complex      106968366 (ELOC) DNA repair and recombination proteins [BR:aju03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      106968366 (ELOC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  106968366 NCBI-ProteinID:  XP_014920211 UniProt:  A0A6I9ZJM0 LinkDB All DBs Position F2:59089253..59112423 Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaagagaaaacctatggcggctgtgaaggccccgatgccatgtatgtcaaa ttgatatcttcggatggtcatgaatttattgtaaaaagagaacacgcactaacatctgga acaataaaagccatgttgagtggcccaggtcagtttgctgagaatgaaactaatgaagtc aattttagagagatcccttcacatgtgctatcaaaagtatgcatgtattttacctacaag gttcgctacactaacagctccacggagattcctgaattcccaattgcacctgaaattgca ctggaactgctgatggctgcgaacttcctagattgttaa

DBGET integrated database retrieval system