Acinonyx jubatus (cheetah): 106968964 Help Entry 106968964         CDS       T04657                                  Symbol MYL11 Name (RefSeq) myosin regulatory light chain 11   KO K12758   fast skeletal myosin light chain 2 Organism aju  Acinonyx jubatus (cheetah) Pathway aju04510   Focal adhesion aju04520   Adherens junction aju04670   Leukocyte transendothelial migration aju04810   Regulation of actin cytoskeleton aju04814   Motor proteins aju04820   Cytoskeleton in muscle cells aju05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aju00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     106968964 (MYL11)    04520 Adherens junction     106968964 (MYL11)   09142 Cell motility    04814 Motor proteins     106968964 (MYL11)    04820 Cytoskeleton in muscle cells     106968964 (MYL11)    04810 Regulation of actin cytoskeleton     106968964 (MYL11)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     106968964 (MYL11)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106968964 (MYL11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aju04812]     106968964 (MYL11)    04147 Exosome [BR:aju04147]     106968964 (MYL11) Cytoskeleton proteins [BR:aju04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      106968964 (MYL11) Exosome [BR:aju04147]  Exosomal proteins   Exosomal proteins of hepatic cells    106968964 (MYL11) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 CFAP251_C SAPC2_N Motif Other DBs NCBI-GeneID:  106968964 NCBI-ProteinID:  XP_014920951 UniProt:  A0A6I9ZIX9 LinkDB All DBs Position E3:18776426..18778649 Genome browser AA seq 170 aa AA seqDB search MAPKKARRRAAAEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGR LNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDHEGKGTIKKQF LEELLTTQCDRFSPEEIRNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggcacccaagaaggccaggagaagggcggcagcagagggcggaagctccagtgtcttc tccatgtttgaccagactcagatccaagagttcaaggaggccttcacggtaattgaccag aaccgtgatggcattatcgacaaggaagatctgcgggacaccttcgcagccatggggcgc ctcaatgtgaagaatgaggagctagatgccatgatgaaggaagccagtggtcccatcaac ttcaccgtcttcctgaccatgtttggagagaagcttaaaggtgctgatcctgaggacgtg atcactggagccttcaaggtcctggatcatgaggggaagggcaccatcaagaagcagttc ctggaggagctgcttaccacgcagtgcgaccgcttctccccggaagagatcaggaacatg tgggcagcgttccccccagacgtgggaggcaatgtagactacaagaacatctgctacgtc atcacgcatggcgacgccaaggaccaggagtag

DBGET integrated database retrieval system