KEGG   Acinonyx jubatus (cheetah): 106969232
Entry
106969232         CDS       T04657                                 
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X2
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01521  EGFR tyrosine kinase inhibitor resistance
aju01522  Endocrine resistance
aju01524  Platinum drug resistance
aju04010  MAPK signaling pathway
aju04012  ErbB signaling pathway
aju04014  Ras signaling pathway
aju04015  Rap1 signaling pathway
aju04022  cGMP-PKG signaling pathway
aju04024  cAMP signaling pathway
aju04062  Chemokine signaling pathway
aju04066  HIF-1 signaling pathway
aju04068  FoxO signaling pathway
aju04071  Sphingolipid signaling pathway
aju04072  Phospholipase D signaling pathway
aju04114  Oocyte meiosis
aju04140  Autophagy - animal
aju04148  Efferocytosis
aju04150  mTOR signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04210  Apoptosis
aju04218  Cellular senescence
aju04261  Adrenergic signaling in cardiomyocytes
aju04270  Vascular smooth muscle contraction
aju04350  TGF-beta signaling pathway
aju04360  Axon guidance
aju04370  VEGF signaling pathway
aju04371  Apelin signaling pathway
aju04380  Osteoclast differentiation
aju04510  Focal adhesion
aju04517  IgSF CAM signaling
aju04520  Adherens junction
aju04540  Gap junction
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04611  Platelet activation
aju04613  Neutrophil extracellular trap formation
aju04620  Toll-like receptor signaling pathway
aju04621  NOD-like receptor signaling pathway
aju04625  C-type lectin receptor signaling pathway
aju04650  Natural killer cell mediated cytotoxicity
aju04657  IL-17 signaling pathway
aju04658  Th1 and Th2 cell differentiation
aju04659  Th17 cell differentiation
aju04660  T cell receptor signaling pathway
aju04662  B cell receptor signaling pathway
aju04664  Fc epsilon RI signaling pathway
aju04666  Fc gamma R-mediated phagocytosis
aju04668  TNF signaling pathway
aju04713  Circadian entrainment
aju04720  Long-term potentiation
aju04722  Neurotrophin signaling pathway
aju04723  Retrograde endocannabinoid signaling
aju04724  Glutamatergic synapse
aju04725  Cholinergic synapse
aju04726  Serotonergic synapse
aju04730  Long-term depression
aju04810  Regulation of actin cytoskeleton
aju04910  Insulin signaling pathway
aju04912  GnRH signaling pathway
aju04914  Progesterone-mediated oocyte maturation
aju04915  Estrogen signaling pathway
aju04916  Melanogenesis
aju04917  Prolactin signaling pathway
aju04919  Thyroid hormone signaling pathway
aju04921  Oxytocin signaling pathway
aju04926  Relaxin signaling pathway
aju04928  Parathyroid hormone synthesis, secretion and action
aju04929  GnRH secretion
aju04930  Type II diabetes mellitus
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju04934  Cushing syndrome
aju04935  Growth hormone synthesis, secretion and action
aju04960  Aldosterone-regulated sodium reabsorption
aju05010  Alzheimer disease
aju05020  Prion disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05034  Alcoholism
aju05132  Salmonella infection
aju05133  Pertussis
aju05135  Yersinia infection
aju05140  Leishmaniasis
aju05142  Chagas disease
aju05145  Toxoplasmosis
aju05152  Tuberculosis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05170  Human immunodeficiency virus 1 infection
aju05171  Coronavirus disease - COVID-19
aju05200  Pathways in cancer
aju05203  Viral carcinogenesis
aju05205  Proteoglycans in cancer
aju05206  MicroRNAs in cancer
aju05207  Chemical carcinogenesis - receptor activation
aju05208  Chemical carcinogenesis - reactive oxygen species
aju05210  Colorectal cancer
aju05211  Renal cell carcinoma
aju05212  Pancreatic cancer
aju05213  Endometrial cancer
aju05214  Glioma
aju05215  Prostate cancer
aju05216  Thyroid cancer
aju05218  Melanoma
aju05219  Bladder cancer
aju05220  Chronic myeloid leukemia
aju05221  Acute myeloid leukemia
aju05223  Non-small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05230  Central carbon metabolism in cancer
aju05231  Choline metabolism in cancer
aju05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aju05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106969232
   04012 ErbB signaling pathway
    106969232
   04014 Ras signaling pathway
    106969232
   04015 Rap1 signaling pathway
    106969232
   04350 TGF-beta signaling pathway
    106969232
   04370 VEGF signaling pathway
    106969232
   04371 Apelin signaling pathway
    106969232
   04668 TNF signaling pathway
    106969232
   04066 HIF-1 signaling pathway
    106969232
   04068 FoxO signaling pathway
    106969232
   04072 Phospholipase D signaling pathway
    106969232
   04071 Sphingolipid signaling pathway
    106969232
   04024 cAMP signaling pathway
    106969232
   04022 cGMP-PKG signaling pathway
    106969232
   04151 PI3K-Akt signaling pathway
    106969232
   04150 mTOR signaling pathway
    106969232
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    106969232
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106969232
   04148 Efferocytosis
    106969232
  09143 Cell growth and death
   04114 Oocyte meiosis
    106969232
   04210 Apoptosis
    106969232
   04218 Cellular senescence
    106969232
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106969232
   04520 Adherens junction
    106969232
   04540 Gap junction
    106969232
   04550 Signaling pathways regulating pluripotency of stem cells
    106969232
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106969232
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    106969232
   04613 Neutrophil extracellular trap formation
    106969232
   04620 Toll-like receptor signaling pathway
    106969232
   04621 NOD-like receptor signaling pathway
    106969232
   04625 C-type lectin receptor signaling pathway
    106969232
   04650 Natural killer cell mediated cytotoxicity
    106969232
   04660 T cell receptor signaling pathway
    106969232
   04658 Th1 and Th2 cell differentiation
    106969232
   04659 Th17 cell differentiation
    106969232
   04657 IL-17 signaling pathway
    106969232
   04662 B cell receptor signaling pathway
    106969232
   04664 Fc epsilon RI signaling pathway
    106969232
   04666 Fc gamma R-mediated phagocytosis
    106969232
   04062 Chemokine signaling pathway
    106969232
  09152 Endocrine system
   04910 Insulin signaling pathway
    106969232
   04929 GnRH secretion
    106969232
   04912 GnRH signaling pathway
    106969232
   04915 Estrogen signaling pathway
    106969232
   04914 Progesterone-mediated oocyte maturation
    106969232
   04917 Prolactin signaling pathway
    106969232
   04921 Oxytocin signaling pathway
    106969232
   04926 Relaxin signaling pathway
    106969232
   04935 Growth hormone synthesis, secretion and action
    106969232
   04919 Thyroid hormone signaling pathway
    106969232
   04928 Parathyroid hormone synthesis, secretion and action
    106969232
   04916 Melanogenesis
    106969232
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106969232
   04270 Vascular smooth muscle contraction
    106969232
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    106969232
  09156 Nervous system
   04724 Glutamatergic synapse
    106969232
   04725 Cholinergic synapse
    106969232
   04726 Serotonergic synapse
    106969232
   04720 Long-term potentiation
    106969232
   04730 Long-term depression
    106969232
   04723 Retrograde endocannabinoid signaling
    106969232
   04722 Neurotrophin signaling pathway
    106969232
  09158 Development and regeneration
   04360 Axon guidance
    106969232
   04380 Osteoclast differentiation
    106969232
  09159 Environmental adaptation
   04713 Circadian entrainment
    106969232
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106969232
   05206 MicroRNAs in cancer
    106969232
   05205 Proteoglycans in cancer
    106969232
   05207 Chemical carcinogenesis - receptor activation
    106969232
   05208 Chemical carcinogenesis - reactive oxygen species
    106969232
   05203 Viral carcinogenesis
    106969232
   05230 Central carbon metabolism in cancer
    106969232
   05231 Choline metabolism in cancer
    106969232
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106969232
  09162 Cancer: specific types
   05210 Colorectal cancer
    106969232
   05212 Pancreatic cancer
    106969232
   05225 Hepatocellular carcinoma
    106969232
   05226 Gastric cancer
    106969232
   05214 Glioma
    106969232
   05216 Thyroid cancer
    106969232
   05221 Acute myeloid leukemia
    106969232
   05220 Chronic myeloid leukemia
    106969232
   05218 Melanoma
    106969232
   05211 Renal cell carcinoma
    106969232
   05219 Bladder cancer
    106969232
   05215 Prostate cancer
    106969232
   05213 Endometrial cancer
    106969232
   05224 Breast cancer
    106969232
   05223 Non-small cell lung cancer
    106969232
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106969232
   05170 Human immunodeficiency virus 1 infection
    106969232
   05161 Hepatitis B
    106969232
   05160 Hepatitis C
    106969232
   05171 Coronavirus disease - COVID-19
    106969232
   05164 Influenza A
    106969232
   05163 Human cytomegalovirus infection
    106969232
   05167 Kaposi sarcoma-associated herpesvirus infection
    106969232
   05165 Human papillomavirus infection
    106969232
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106969232
   05135 Yersinia infection
    106969232
   05133 Pertussis
    106969232
   05152 Tuberculosis
    106969232
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106969232
   05140 Leishmaniasis
    106969232
   05142 Chagas disease
    106969232
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106969232
   05020 Prion disease
    106969232
   05022 Pathways of neurodegeneration - multiple diseases
    106969232
  09165 Substance dependence
   05034 Alcoholism
    106969232
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    106969232
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    106969232
   04933 AGE-RAGE signaling pathway in diabetic complications
    106969232
   04934 Cushing syndrome
    106969232
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106969232
   01524 Platinum drug resistance
    106969232
   01522 Endocrine resistance
    106969232
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106969232
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106969232
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aju04147]
    106969232
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106969232
Protein kinases [BR:aju01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106969232
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     106969232
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106969232
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 106969232
NCBI-ProteinID: XP_014921255
UniProt: A0A6I9ZGD8
LinkDB
Position
E3:18349194..18355420
AA seq 379 aa
MAAAAAQGGGGGEPGGADGVGPGVSGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
AKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGALEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagcccgggggagctgatggggtc
ggcccgggggtctcgggggaggtggaggtagtgaaggggcagccgttcgacgtgggcccg
cgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagcttat
gaccacgtgcgcaagactcgcgtggccatcaagaaaatcagccccttcgagcatcagacc
tattgccagcgcacactgcgggagatccagatcttgctgcgcttccgccatgagaacgtc
attggcatccgggacattctgcgggcgcccaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcagctgagcaac
gaccacatttgctacttcctctaccagatcctgcggggcctcaagtatatccactcagcc
aacgtgctccaccgggatttaaagccctctaacctgctcatcaacaccacctgcgacctt
aagatctgtgattttggcctggcccggattgccgatcctgagcatgaccacactggcttc
ctgacagaatatgtggccacacgctggtaccgggctccagaaatcatgcttaactccaag
ggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aacaggcccatcttccctggcaagcactacctggaccagctcaaccacattctggggatt
ctgggctccccatcccaggaggacttgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcctgggccaagctttttcccaagtcagat
gccaaagcccttgatctgctagaccggatgttgacctttaaccccaacaaacggatcaca
gtggaggaagcactggctcacccctacctggagcagtactacgaccccacggatgagcca
gtggccgaggagcctttcaccttcgacatggagctggatgatctacccaaggagcggctg
aaggagctcatcttccaggagacagcccgcttccagcctggggcactggaggccccctaa

DBGET integrated database retrieval system