Acinonyx jubatus (cheetah): 106969596 Help Entry 106969596         CDS       T04657                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism aju  Acinonyx jubatus (cheetah) Pathway aju01521   EGFR tyrosine kinase inhibitor resistance aju01522   Endocrine resistance aju04010   MAPK signaling pathway aju04012   ErbB signaling pathway aju04014   Ras signaling pathway aju04015   Rap1 signaling pathway aju04062   Chemokine signaling pathway aju04068   FoxO signaling pathway aju04071   Sphingolipid signaling pathway aju04072   Phospholipase D signaling pathway aju04137   Mitophagy - animal aju04140   Autophagy - animal aju04150   mTOR signaling pathway aju04151   PI3K-Akt signaling pathway aju04210   Apoptosis aju04211   Longevity regulating pathway aju04213   Longevity regulating pathway - multiple species aju04218   Cellular senescence aju04360   Axon guidance aju04370   VEGF signaling pathway aju04371   Apelin signaling pathway aju04540   Gap junction aju04550   Signaling pathways regulating pluripotency of stem cells aju04625   C-type lectin receptor signaling pathway aju04650   Natural killer cell mediated cytotoxicity aju04660   T cell receptor signaling pathway aju04662   B cell receptor signaling pathway aju04664   Fc epsilon RI signaling pathway aju04714   Thermogenesis aju04720   Long-term potentiation aju04722   Neurotrophin signaling pathway aju04725   Cholinergic synapse aju04726   Serotonergic synapse aju04730   Long-term depression aju04810   Regulation of actin cytoskeleton aju04910   Insulin signaling pathway aju04912   GnRH signaling pathway aju04915   Estrogen signaling pathway aju04916   Melanogenesis aju04917   Prolactin signaling pathway aju04919   Thyroid hormone signaling pathway aju04921   Oxytocin signaling pathway aju04926   Relaxin signaling pathway aju04929   GnRH secretion aju04933   AGE-RAGE signaling pathway in diabetic complications aju04935   Growth hormone synthesis, secretion and action aju05010   Alzheimer disease aju05022   Pathways of neurodegeneration - multiple diseases aju05034   Alcoholism aju05160   Hepatitis C aju05161   Hepatitis B aju05163   Human cytomegalovirus infection aju05165   Human papillomavirus infection aju05166   Human T-cell leukemia virus 1 infection aju05167   Kaposi sarcoma-associated herpesvirus infection aju05170   Human immunodeficiency virus 1 infection aju05200   Pathways in cancer aju05203   Viral carcinogenesis aju05205   Proteoglycans in cancer aju05206   MicroRNAs in cancer aju05207   Chemical carcinogenesis - receptor activation aju05208   Chemical carcinogenesis - reactive oxygen species aju05210   Colorectal cancer aju05211   Renal cell carcinoma aju05213   Endometrial cancer aju05214   Glioma aju05215   Prostate cancer aju05216   Thyroid cancer aju05218   Melanoma aju05219   Bladder cancer aju05220   Chronic myeloid leukemia aju05221   Acute myeloid leukemia aju05223   Non-small cell lung cancer aju05224   Breast cancer aju05225   Hepatocellular carcinoma aju05226   Gastric cancer aju05230   Central carbon metabolism in cancer aju05231   Choline metabolism in cancer aju05235   PD-L1 expression and PD-1 checkpoint pathway in cancer aju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106969596    04012 ErbB signaling pathway     106969596    04014 Ras signaling pathway     106969596    04015 Rap1 signaling pathway     106969596    04370 VEGF signaling pathway     106969596    04371 Apelin signaling pathway     106969596    04068 FoxO signaling pathway     106969596    04072 Phospholipase D signaling pathway     106969596    04071 Sphingolipid signaling pathway     106969596    04151 PI3K-Akt signaling pathway     106969596    04150 mTOR signaling pathway     106969596  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106969596    04137 Mitophagy - animal     106969596   09143 Cell growth and death    04210 Apoptosis     106969596    04218 Cellular senescence     106969596   09144 Cellular community - eukaryotes    04540 Gap junction     106969596    04550 Signaling pathways regulating pluripotency of stem cells     106969596   09142 Cell motility    04810 Regulation of actin cytoskeleton     106969596  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106969596    04650 Natural killer cell mediated cytotoxicity     106969596    04660 T cell receptor signaling pathway     106969596    04662 B cell receptor signaling pathway     106969596    04664 Fc epsilon RI signaling pathway     106969596    04062 Chemokine signaling pathway     106969596   09152 Endocrine system    04910 Insulin signaling pathway     106969596    04929 GnRH secretion     106969596    04912 GnRH signaling pathway     106969596    04915 Estrogen signaling pathway     106969596    04917 Prolactin signaling pathway     106969596    04921 Oxytocin signaling pathway     106969596    04926 Relaxin signaling pathway     106969596    04935 Growth hormone synthesis, secretion and action     106969596    04919 Thyroid hormone signaling pathway     106969596    04916 Melanogenesis     106969596   09156 Nervous system    04725 Cholinergic synapse     106969596    04726 Serotonergic synapse     106969596    04720 Long-term potentiation     106969596    04730 Long-term depression     106969596    04722 Neurotrophin signaling pathway     106969596   09158 Development and regeneration    04360 Axon guidance     106969596   09149 Aging    04211 Longevity regulating pathway     106969596    04213 Longevity regulating pathway - multiple species     106969596   09159 Environmental adaptation    04714 Thermogenesis     106969596  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106969596    05206 MicroRNAs in cancer     106969596    05205 Proteoglycans in cancer     106969596    05207 Chemical carcinogenesis - receptor activation     106969596    05208 Chemical carcinogenesis - reactive oxygen species     106969596    05203 Viral carcinogenesis     106969596    05230 Central carbon metabolism in cancer     106969596    05231 Choline metabolism in cancer     106969596    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     106969596   09162 Cancer: specific types    05210 Colorectal cancer     106969596    05225 Hepatocellular carcinoma     106969596    05226 Gastric cancer     106969596    05214 Glioma     106969596    05216 Thyroid cancer     106969596    05221 Acute myeloid leukemia     106969596    05220 Chronic myeloid leukemia     106969596    05218 Melanoma     106969596    05211 Renal cell carcinoma     106969596    05219 Bladder cancer     106969596    05215 Prostate cancer     106969596    05213 Endometrial cancer     106969596    05224 Breast cancer     106969596    05223 Non-small cell lung cancer     106969596   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     106969596    05170 Human immunodeficiency virus 1 infection     106969596    05161 Hepatitis B     106969596    05160 Hepatitis C     106969596    05163 Human cytomegalovirus infection     106969596    05167 Kaposi sarcoma-associated herpesvirus infection     106969596    05165 Human papillomavirus infection     106969596   09164 Neurodegenerative disease    05010 Alzheimer disease     106969596    05022 Pathways of neurodegeneration - multiple diseases     106969596   09165 Substance dependence    05034 Alcoholism     106969596   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106969596   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     106969596   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     106969596    01522 Endocrine resistance     106969596  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aju04131]     106969596   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aju04147]     106969596    04031 GTP-binding proteins [BR:aju04031]     106969596 Membrane trafficking [BR:aju04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     106969596  Endocytosis   Macropinocytosis    Ras GTPases     106969596 Exosome [BR:aju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106969596   Exosomal proteins of other body fluids (saliva and urine)    106969596   Exosomal proteins of breast cancer cells    106969596   Exosomal proteins of colorectal cancer cells    106969596 GTP-binding proteins [BR:aju04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106969596 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  106969596 NCBI-ProteinID:  XP_014921595 UniProt:  A0A6I9ZI56 LinkDB All DBs Position C1:complement(96464887..96475405) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaacaatagcaaatcatttgcagatattaacctttacagggaacagatt aagcgagtaaaagactccgatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggactgtcgacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system