Acinonyx jubatus (cheetah): 106971134 Help Entry 106971134         CDS       T04657                                  Name (RefSeq) interferon alpha   KO K05414   interferon alpha Organism aju  Acinonyx jubatus (cheetah) Pathway aju04060   Cytokine-cytokine receptor interaction aju04151   PI3K-Akt signaling pathway aju04217   Necroptosis aju04620   Toll-like receptor signaling pathway aju04621   NOD-like receptor signaling pathway aju04622   RIG-I-like receptor signaling pathway aju04623   Cytosolic DNA-sensing pathway aju04630   JAK-STAT signaling pathway aju04650   Natural killer cell mediated cytotoxicity aju04936   Alcoholic liver disease aju05152   Tuberculosis aju05160   Hepatitis C aju05161   Hepatitis B aju05162   Measles aju05163   Human cytomegalovirus infection aju05164   Influenza A aju05165   Human papillomavirus infection aju05167   Kaposi sarcoma-associated herpesvirus infection aju05168   Herpes simplex virus 1 infection aju05169   Epstein-Barr virus infection aju05170   Human immunodeficiency virus 1 infection aju05171   Coronavirus disease - COVID-19 aju05200   Pathways in cancer aju05320   Autoimmune thyroid disease aju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     106971134    04151 PI3K-Akt signaling pathway     106971134   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106971134  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     106971134  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106971134    04621 NOD-like receptor signaling pathway     106971134    04622 RIG-I-like receptor signaling pathway     106971134    04623 Cytosolic DNA-sensing pathway     106971134    04650 Natural killer cell mediated cytotoxicity     106971134  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106971134   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     106971134    05161 Hepatitis B     106971134    05160 Hepatitis C     106971134    05171 Coronavirus disease - COVID-19     106971134    05164 Influenza A     106971134    05162 Measles     106971134    05168 Herpes simplex virus 1 infection     106971134    05163 Human cytomegalovirus infection     106971134    05167 Kaposi sarcoma-associated herpesvirus infection     106971134    05169 Epstein-Barr virus infection     106971134    05165 Human papillomavirus infection     106971134   09171 Infectious disease: bacterial    05152 Tuberculosis     106971134   09163 Immune disease    05320 Autoimmune thyroid disease     106971134   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106971134   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     106971134  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aju04052]     106971134 Cytokines and neuropeptides [BR:aju04052]  Cytokines   Interferons    106971134 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  106971134 NCBI-ProteinID:  XP_014923386 UniProt:  A0A6I9ZP66 LinkDB All DBs Position D4:complement(47962191..47963178) Genome browser AA seq 213 aa AA seqDB search MFREPRATGHRPTPARPTASARSPMALPCSFLVALVALGCNSVCSLGCDLPQTHGLLNRR ALTLLGQMRRLPASSCQKDRNDFAFPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEAS SSAAWNTTLLEEFCTGLDRQLTRLEACVVQEAGEGEAPLTNEDSILRNYFQRLSLYLQEK KYSPCAWEIVRAEIMRSLYYSSTALQKRLRSEK NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atgttcagagaacctagagccacgggtcacaggcccaccccagccaggccaacagcatct gcaagatccccaatggcgctgccctgttccttcttggtggccctggtggcgctgggctgc aactccgtctgctctctgggctgtgacctgcctcagacccacggcctgctgaacaggagg gccttgacgctcctgggacaaatgaggagactccctgccagctcctgccagaaggacaga aatgacttcgccttcccccaggacgtgtttggtggagaccagtcccacaaggcccaagcc ctctctgtggtgcacgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcc tcgtctgctgcttggaacaccaccctcctggaggaattctgcacgggacttgatcggcag ctgacccgcctggaagcctgtgtcgtgcaggaggcgggggagggagaggctcccctcacg aacgaggactccatcctgaggaactacttccaaagactctccctctacctgcaagagaag aaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtattat tcatcaacagccttgcagaaaagattaaggagcgagaaatga

DBGET integrated database retrieval system