Acinonyx jubatus (cheetah): 106971215 Help Entry 106971215         CDS       T04657                                  Name (RefSeq) cofilin-1   KO K05765   cofilin Organism aju  Acinonyx jubatus (cheetah) Pathway aju04360   Axon guidance aju04666   Fc gamma R-mediated phagocytosis aju04810   Regulation of actin cytoskeleton aju05133   Pertussis aju05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:aju00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     106971215  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     106971215   09158 Development and regeneration    04360 Axon guidance     106971215  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     106971215   09171 Infectious disease: bacterial    05133 Pertussis     106971215  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aju04131]     106971215   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aju04812]     106971215    04147 Exosome [BR:aju04147]     106971215 Membrane trafficking [BR:aju04131]  Others   Actin-binding proteins    Others     106971215 Cytoskeleton proteins [BR:aju04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      106971215 Exosome [BR:aju04147]  Exosomal proteins   Proteins found in most exosomes    106971215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  106971215 NCBI-ProteinID:  XP_026901394 UniProt:  A0A6J1Y9Y5 LinkDB All DBs Position D1:6617278..6620894 Genome browser AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggcagtctctgatggtgtcatcaaagtgttcaatgacatgaaggtt cgtaagtcctcaacaccagaggaggtgaagaagcgcaagaaggcggtactcttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggtgatgtg ggccagactgtagacgacccctacgccacctttgtcaagatgctgccagacaaggactgc cgctatgccctctatgatgccacctatgagaccaaggagagcaagaaggaggacctggtg tttatcttctgggcacctgaatgtgcacccctcaagagcaaaatgatttatgccagctcc aaggacgccatcaagaagaagctgacggggatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgctgcaccctggccgagaaactggggggcagcgccgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system