Acinonyx jubatus (cheetah): 106971760 Help Entry 106971760         CDS       T04657                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism aju  Acinonyx jubatus (cheetah) Pathway aju04621   NOD-like receptor signaling pathway aju05012   Parkinson disease aju05132   Salmonella infection aju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     106971760  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106971760   09164 Neurodegenerative disease    05012 Parkinson disease     106971760   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     106971760  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aju03110]     106971760 Chaperones and folding catalysts [BR:aju03110]  Protein folding catalysts   Protein disulfide isomerase    106971760 SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 DIM1 Thioredoxin_8 A6-like_Thioredoxin-like_C OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin PedC-like Motif Other DBs NCBI-GeneID:  106971760 NCBI-ProteinID:  XP_026890610 UniProt:  A0A6J1XDR1 LinkDB All DBs Position 12 Genome browser AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtatgcttttcaggaagccttgaacagtgcaggggaa aaacttgtagtagttgatttctctgccacgtggtgtggaccttgcaaaatgatcaagccc ttctttcattccctctctgagaagtattccaacgtggtgttccttgaagtagacgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggagctaataaggaaaaacttgaagctacc atcaatgaattaatctaa

DBGET integrated database retrieval system