Acinonyx jubatus (cheetah): 106972076 Help Entry 106972076         CDS       T04657                                  Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism aju  Acinonyx jubatus (cheetah) Pathway aju04010   MAPK signaling pathway aju04020   Calcium signaling pathway aju04022   cGMP-PKG signaling pathway aju04114   Oocyte meiosis aju04218   Cellular senescence aju04310   Wnt signaling pathway aju04360   Axon guidance aju04370   VEGF signaling pathway aju04380   Osteoclast differentiation aju04625   C-type lectin receptor signaling pathway aju04650   Natural killer cell mediated cytotoxicity aju04658   Th1 and Th2 cell differentiation aju04659   Th17 cell differentiation aju04660   T cell receptor signaling pathway aju04662   B cell receptor signaling pathway aju04720   Long-term potentiation aju04724   Glutamatergic synapse aju04921   Oxytocin signaling pathway aju04922   Glucagon signaling pathway aju04924   Renin secretion aju05010   Alzheimer disease aju05014   Amyotrophic lateral sclerosis aju05020   Prion disease aju05022   Pathways of neurodegeneration - multiple diseases aju05031   Amphetamine addiction aju05152   Tuberculosis aju05163   Human cytomegalovirus infection aju05166   Human T-cell leukemia virus 1 infection aju05167   Kaposi sarcoma-associated herpesvirus infection aju05170   Human immunodeficiency virus 1 infection aju05235   PD-L1 expression and PD-1 checkpoint pathway in cancer aju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106972076    04310 Wnt signaling pathway     106972076    04370 VEGF signaling pathway     106972076    04020 Calcium signaling pathway     106972076    04022 cGMP-PKG signaling pathway     106972076  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     106972076    04218 Cellular senescence     106972076  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106972076    04650 Natural killer cell mediated cytotoxicity     106972076    04660 T cell receptor signaling pathway     106972076    04658 Th1 and Th2 cell differentiation     106972076    04659 Th17 cell differentiation     106972076    04662 B cell receptor signaling pathway     106972076   09152 Endocrine system    04922 Glucagon signaling pathway     106972076    04921 Oxytocin signaling pathway     106972076    04924 Renin secretion     106972076   09156 Nervous system    04724 Glutamatergic synapse     106972076    04720 Long-term potentiation     106972076   09158 Development and regeneration    04360 Axon guidance     106972076    04380 Osteoclast differentiation     106972076  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     106972076   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     106972076    05170 Human immunodeficiency virus 1 infection     106972076    05163 Human cytomegalovirus infection     106972076    05167 Kaposi sarcoma-associated herpesvirus infection     106972076   09171 Infectious disease: bacterial    05152 Tuberculosis     106972076   09164 Neurodegenerative disease    05010 Alzheimer disease     106972076    05014 Amyotrophic lateral sclerosis     106972076    05020 Prion disease     106972076    05022 Pathways of neurodegeneration - multiple diseases     106972076   09165 Substance dependence    05031 Amphetamine addiction     106972076   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106972076  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aju01009]     106972076 Protein phosphatases and associated proteins [BR:aju01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      106972076 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  106972076 NCBI-ProteinID:  XP_053060838 UniProt:  A0A6I9ZKB3 LinkDB All DBs Position D4:30461531..30464846 Genome browser AA seq 170 aa AA seqDB search MGNEASYPTEMCSHFNHDEIKRLSKRFKKLDLDCSGSLSVDEFLSLPELRQNPLVQRVID VFDTDGNGEVDFEEFVVGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV RNNLQDWQLQQIVDKTIIILDRDGDGRISFEEFSAVVGNLEVHKKLVVTV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagctagttacccgacggagatgtgttcccacttcaaccacgatgaaatt aaaaggctgagcaagaggtttaagaagctggacttggactgttcgggctctctgagcgtg gacgagttcttgtccctgcccgagctgcggcagaacccgttggtgcagcgagtgatcgac gtcttcgacaccgacggcaatggagaggtggactttgaggagttcgtcgtggggacctcc cagttcagcgtcaggggggacgaggagcagaagttgaggtttgccttcagcatctacgac atggataaagacggctacatttccaacggggagctgttccaggtgctgaagatgatggtg aggaacaacctgcaagactggcagttacagcagatcgtggacaaaactatcatcatcctg gacagggatggcgacgggagaatatccttcgaggaattcagtgccgtggtcggaaacctg gaggtccacaagaagttggtggtaactgtgtga

DBGET integrated database retrieval system