Acinonyx jubatus (cheetah): 106973875 Help Entry 106973875         CDS       T04657                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism aju  Acinonyx jubatus (cheetah) Pathway aju00190   Oxidative phosphorylation aju01100   Metabolic pathways aju01524   Platinum drug resistance aju04115   p53 signaling pathway aju04210   Apoptosis aju04215   Apoptosis - multiple species aju04932   Non-alcoholic fatty liver disease aju05010   Alzheimer disease aju05012   Parkinson disease aju05014   Amyotrophic lateral sclerosis aju05016   Huntington disease aju05017   Spinocerebellar ataxia aju05020   Prion disease aju05022   Pathways of neurodegeneration - multiple diseases aju05132   Salmonella infection aju05134   Legionellosis aju05145   Toxoplasmosis aju05152   Tuberculosis aju05160   Hepatitis C aju05161   Hepatitis B aju05162   Measles aju05163   Human cytomegalovirus infection aju05164   Influenza A aju05167   Kaposi sarcoma-associated herpesvirus infection aju05168   Herpes simplex virus 1 infection aju05169   Epstein-Barr virus infection aju05170   Human immunodeficiency virus 1 infection aju05200   Pathways in cancer aju05210   Colorectal cancer aju05222   Small cell lung cancer aju05416   Viral myocarditis aju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     106973875  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     106973875    04215 Apoptosis - multiple species     106973875    04115 p53 signaling pathway     106973875  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106973875   09162 Cancer: specific types    05210 Colorectal cancer     106973875    05222 Small cell lung cancer     106973875   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     106973875    05161 Hepatitis B     106973875    05160 Hepatitis C     106973875    05164 Influenza A     106973875    05162 Measles     106973875    05168 Herpes simplex virus 1 infection     106973875    05163 Human cytomegalovirus infection     106973875    05167 Kaposi sarcoma-associated herpesvirus infection     106973875    05169 Epstein-Barr virus infection     106973875   09171 Infectious disease: bacterial    05132 Salmonella infection     106973875    05134 Legionellosis     106973875    05152 Tuberculosis     106973875   09174 Infectious disease: parasitic    05145 Toxoplasmosis     106973875   09164 Neurodegenerative disease    05010 Alzheimer disease     106973875    05012 Parkinson disease     106973875    05014 Amyotrophic lateral sclerosis     106973875    05016 Huntington disease     106973875    05017 Spinocerebellar ataxia     106973875    05020 Prion disease     106973875    05022 Pathways of neurodegeneration - multiple diseases     106973875   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106973875    05416 Viral myocarditis     106973875   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     106973875   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     106973875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  106973875 NCBI-ProteinID:  XP_053077170 LinkDB All DBs Position C2:87875695..87876319 Genome browser AA seq 94 aa AA seqDB search MGDVEKGKEIFVQKCAQCHTVGKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNNGITW GEETLMEYLENPKKYIPGTKMIFAVIKRQGKEQA NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaagggcaaggagatttttgttcagaagtgtgcccagtgccatact gtgggaaagggaggcaagcataagactgggccaaatctccatggtttatttgggcgaaag acaggtcaagcccctggattttcttacacggatgccaacaagaacaatggcatcacctgg ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctgtcattaaaaggcaggggaaagagcaggcttga

DBGET integrated database retrieval system