Acinonyx jubatus (cheetah): 106974444 Help Entry 106974444         CDS       T04657                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism aju  Acinonyx jubatus (cheetah) Pathway aju04613   Neutrophil extracellular trap formation aju05034   Alcoholism aju05202   Transcriptional misregulation in cancer aju05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:aju00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106974444  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     106974444   09163 Immune disease    05322 Systemic lupus erythematosus     106974444   09165 Substance dependence    05034 Alcoholism     106974444  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aju03036]     106974444   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aju04147]     106974444 Chromosome and associated proteins [BR:aju03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106974444 Exosome [BR:aju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106974444 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S TFIID-31kDa PAF CBFD_NFYB_HMF Bromo_TP Motif Other DBs NCBI-GeneID:  106974444 NCBI-ProteinID:  XP_014927166 UniProt:  A0A6I9ZPZ9 LinkDB All DBs Position B3:complement(116406439..116406939) Genome browser AA seq 136 aa AA seqDB search MARTKQPASKSTGDRARRKQLATKAARKSASSTGGVKKPHRYRPGTVALREIRRSQKSTA LLFHELPFQRLVREVAQDFKTDLRFQSAAISALQEASEAYLVSLFEDTSLCAIHAKRVTI MPKDVQLAHRIRGERG NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagcctgccagcaaatccactggggatagagcacgaaggaagcaa ctggctacaaaagccgctcgcaagagtgcgtcctctactggaggggtgaagaaacctcat cgttacaggcctggtaccgtggcactccgcgaaattagacgttcccagaagtccactgca cttctgttccacgaacttcctttccagcgtctggtgcgagaagttgctcaggacttcaaa acagacctgcgcttccagagcgcggctatcagtgctttgcaggaggcaagcgaggcttac ctggtgagcctcttcgaagacaccagcctgtgcgctatccatgcaaaacgtgtaacaatt atgccaaaagacgtccagctagcgcaccgcatacgtggagaacgtggttaa

DBGET integrated database retrieval system