Acinonyx jubatus (cheetah): 106974986 Help Entry 106974986         CDS       T04657                                  Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism aju  Acinonyx jubatus (cheetah) Pathway aju01522   Endocrine resistance aju04010   MAPK signaling pathway aju04012   ErbB signaling pathway aju04024   cAMP signaling pathway aju04137   Mitophagy - animal aju04210   Apoptosis aju04310   Wnt signaling pathway aju04380   Osteoclast differentiation aju04510   Focal adhesion aju04530   Tight junction aju04620   Toll-like receptor signaling pathway aju04621   NOD-like receptor signaling pathway aju04625   C-type lectin receptor signaling pathway aju04657   IL-17 signaling pathway aju04658   Th1 and Th2 cell differentiation aju04659   Th17 cell differentiation aju04660   T cell receptor signaling pathway aju04662   B cell receptor signaling pathway aju04668   TNF signaling pathway aju04722   Neurotrophin signaling pathway aju04912   GnRH signaling pathway aju04915   Estrogen signaling pathway aju04921   Oxytocin signaling pathway aju04926   Relaxin signaling pathway aju04932   Non-alcoholic fatty liver disease aju04933   AGE-RAGE signaling pathway in diabetic complications aju05030   Cocaine addiction aju05031   Amphetamine addiction aju05132   Salmonella infection aju05133   Pertussis aju05135   Yersinia infection aju05140   Leishmaniasis aju05142   Chagas disease aju05161   Hepatitis B aju05162   Measles aju05166   Human T-cell leukemia virus 1 infection aju05167   Kaposi sarcoma-associated herpesvirus infection aju05169   Epstein-Barr virus infection aju05170   Human immunodeficiency virus 1 infection aju05171   Coronavirus disease - COVID-19 aju05200   Pathways in cancer aju05203   Viral carcinogenesis aju05207   Chemical carcinogenesis - receptor activation aju05208   Chemical carcinogenesis - reactive oxygen species aju05210   Colorectal cancer aju05211   Renal cell carcinoma aju05224   Breast cancer aju05231   Choline metabolism in cancer aju05235   PD-L1 expression and PD-1 checkpoint pathway in cancer aju05321   Inflammatory bowel disease aju05323   Rheumatoid arthritis aju05417   Lipid and atherosclerosis aju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106974986    04012 ErbB signaling pathway     106974986    04310 Wnt signaling pathway     106974986    04668 TNF signaling pathway     106974986    04024 cAMP signaling pathway     106974986  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     106974986   09143 Cell growth and death    04210 Apoptosis     106974986   09144 Cellular community - eukaryotes    04510 Focal adhesion     106974986    04530 Tight junction     106974986  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106974986    04621 NOD-like receptor signaling pathway     106974986    04625 C-type lectin receptor signaling pathway     106974986    04660 T cell receptor signaling pathway     106974986    04658 Th1 and Th2 cell differentiation     106974986    04659 Th17 cell differentiation     106974986    04657 IL-17 signaling pathway     106974986    04662 B cell receptor signaling pathway     106974986   09152 Endocrine system    04912 GnRH signaling pathway     106974986    04915 Estrogen signaling pathway     106974986    04921 Oxytocin signaling pathway     106974986    04926 Relaxin signaling pathway     106974986   09156 Nervous system    04722 Neurotrophin signaling pathway     106974986   09158 Development and regeneration    04380 Osteoclast differentiation     106974986  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106974986    05207 Chemical carcinogenesis - receptor activation     106974986    05208 Chemical carcinogenesis - reactive oxygen species     106974986    05203 Viral carcinogenesis     106974986    05231 Choline metabolism in cancer     106974986    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     106974986   09162 Cancer: specific types    05210 Colorectal cancer     106974986    05211 Renal cell carcinoma     106974986    05224 Breast cancer     106974986   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     106974986    05170 Human immunodeficiency virus 1 infection     106974986    05161 Hepatitis B     106974986    05171 Coronavirus disease - COVID-19     106974986    05162 Measles     106974986    05167 Kaposi sarcoma-associated herpesvirus infection     106974986    05169 Epstein-Barr virus infection     106974986   09171 Infectious disease: bacterial    05132 Salmonella infection     106974986    05135 Yersinia infection     106974986    05133 Pertussis     106974986   09174 Infectious disease: parasitic    05140 Leishmaniasis     106974986    05142 Chagas disease     106974986   09163 Immune disease    05323 Rheumatoid arthritis     106974986    05321 Inflammatory bowel disease     106974986   09165 Substance dependence    05030 Cocaine addiction     106974986    05031 Amphetamine addiction     106974986   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106974986    05418 Fluid shear stress and atherosclerosis     106974986   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     106974986    04933 AGE-RAGE signaling pathway in diabetic complications     106974986   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     106974986  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:aju03000]     106974986 Transcription factors [BR:aju03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     106974986 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_Maf bZIP_2 Rab11-FIP3 ZapB RIMB1_N MIC19_MIC25 CCDC192 PspA_IM30 Fib_alpha T4SS_LegC2C7 DUF3450 TFIIA FlaC_arch Map3k7cl Motif Other DBs NCBI-GeneID:  106974986 NCBI-ProteinID:  XP_026914849 UniProt:  A0A6J1ZDN0 LinkDB All DBs Position C1:complement(47215533..47218273) Genome browser AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggtgcctacggctacagtaaccccaagatcctgaaacagagcatgaccctg aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctggcctcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcctgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg ggcatggtggctccggcggtggcttcggcggcgggcggcagcggcagcggtggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgct ctgagcagcggcggtggggcgccctcctacggcgcggccggcctggcctttcccgcgcag ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagatccccgtg cagcacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgagatgcccggg gaaacgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcggagagg aagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatc gcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaatatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system